Citrus Sinensis ID: 038705

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-

MEDLGRKFFRDLHAKSFFQQSSCDTSRFVMHHLINDLAQWAAGDIYFRMGDVLEDHKRHRFSENLRHFSYLRGGYDGLKMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLYMLFKLQRLRVLSLRGYSIFHVPSSIGDLKHLQYLDLSETKIKTLPESVNKLWNLHTLLLENCHRLKKLCANMGSLIKLHHLKNSNVKALEEMPKGIGNLTHLLTLSRFVVGKDVGSGLRTLKLLKHLQGTLDISKLENVKDASEAKEAQLIEKRNLLRLLLEWTSSTSDDPMEHENVTLMLDGLKPHRNLEELTIRGYGGTTFPTWMGDSSFANLVLLRFEGCHRCTSLPSVGQLPLLKHLFIIEMTSVKMVGSEFYGNHCSVPFPSLETLCFQDIQEWEGWIPHGSGKEVNVFPQLRELSLIGCPKLQGRLPECLSSLERLVVRGCEQLTVLVSSLPKLCKLEIGGCKGMAWRSTNDVNRCCPQLLWLIAEEEQDQQQPVFPCSLQYLELSQCRYLVKLPQALLSLGFLREMEIYGNLIKEESIQSSSTRYTSLLEYLYIDDCASLTSLLPKNELPATLEHLHVKSCGNLAFLSLVGNLPKALKYLSVDHCLKLKSLAERLDNNSSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNLISFPDGGFLSSTLTKLWIYECEKLKALPNGMHNLTSLQELEIGDLPSMVYFPEDGFPTNLHSLEIRDMKMWKSLIEWEPLNRFTSLRRLSIHGCQDMVSFPQDNIGMMLPASLTKLEIVRFSNLEYLSSVGESLPSLECLILDDCPKLRYFPDKGLPPSLLQLHISNCPLIEESCRKDGGQYWHLISDIPCVYINFRCVFDVSD

cHHHHHHHHHHHHHcccccEEccccccEEEcHHHHHHHHHHHHcccEEcccEEcccccccccccEEEEEEEEcccccccccccccccccccEEEcccccccccccHHHHHHHHHHHcccccEEEEEccccccccccccccccccccEEcccccccccccccccccccccEEEcccccccHHHHHcccccccccEEEEccccccccccccccccccccccccEEEcccccccHHHcccccccccEEEEEcccccccHHHHHHHccccccccccEEEEEcccccccccccHHHHccccccccccccccEEEEEEccccccccccccccccEEEEEEEccccccccccccccccccEEEccccccEEEEcccccccccccccccccEEEEcccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccEEEEccccccccccccccccccccHHHHHHHHHcccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEcccccEEccccccccccccEEEEEcccccccccccccccccccEEEEccccccccHHccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEEEccccccccccccccccccEEEEEccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccEEccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEccHHHHHHHcccccccccccccccEEEEccEEEEEccc

ccHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHHccEEEEEHHHccccccccccccEEEEEEEcccccccccccHHHHHHHccEEEccccccccccccHHHHHHHHHHHHccEEEEEEEcccccccccccccccHHEEEEEccccccccccHHHHHHHHHHHHHHcccHHHHHccHHHHccccccEEEcccccccccccccccccccccEEcEEEEcccccccHHHHHHHHHcccEEEEEcccccccHHHHHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHccccccccEEEEEccccccccccccccccHccEEEEEcccccccccccccccccccEEEEcccccEEEccHHHcccccccccccccEEEccccHHHHHHccccccccccccccHHEEEEccccHHHcccccccccccEEEEcccccHcccccccccccEEEEEccccEEcccccccHHHHHHHHHcccccccccccccccccccEEEEccccccccccccccccccccEEEEcccccHcccccHccccccccHcEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEEcccccHccccccccccccccEEEEccccccccccccccccccccEEEEcccHHHccccccccccccccEEEEcccccccccccccccccccEEEEcccHHHHcccHHccccccccccEEEEcccccccccccccccccccccccEEEEcccccHHcccHHccccccccEEEEcccccHcccccccccccccEEEEcccHHHHHHHHcccccccccEEEccEEEEccEEEEEccc

medlgrkffrdlhaksffqqsscdtsrFVMHHLINDLAQWAAGDIYFRMGDVLEDHKRHRFSENLRHFSYLRGGYDGLKMFEVLSDAKRLRTFLPlvlsntwsgkaYLAHSVLYMLFKLQRLRVLSLRgysifhvpssigdlkhlqyldlsetKIKTLPESVNKLWNLHTLLLENCHRLKKLCANMGSliklhhlknsNVKALEEMPKGIGNLTHLLTLSRfvvgkdvgsgLRTLKLLKHLQgtldisklenvkdaSEAKEAQLIEKRNLLRLLLEWtsstsddpmehENVTLMLdglkphrnleeltirgyggttfptwmgdssfANLVLLRFEgchrctslpsvgqlpllkHLFIIEMTSVKmvgsefygnhcsvpfpsletlCFQDIQewegwiphgsgkevnvfpqlrelsligcpklqgrlpeCLSSLERLVVRGCEQLTVLVSSLPklckleiggckgmawrstndvnrccPQLLWLIAEeeqdqqqpvfpcslqylelsQCRYLVKLPQALLSLGFLREMEIYGNLIKEESIQSSSTRYTSLLEYLYIddcasltsllpknelpatLEHLHVKSCGNLAFLSLVGNLPKALKYLSVDHCLKLKSLAERldnnssleavKISYCENLIVLPDGLLKLNHLQEIFishcpnlisfpdggflsstLTKLWIYECEKLkalpngmhnltslqeleigdlpsmvyfpedgfptnlhslEIRDMKMWKSLIeweplnrftslrrlsihgcqdmvsfpqdnigmmlpasLTKLEIVRFSNLEYLSSvgeslpsleclilddcpklryfpdkglppsllqlhisncplieescrkdggqywhlisdipcvyinfrcvfdvsd

MEDLGRKFFrdlhaksffqqsscDTSRFVMHHLINDLAQWAAGDIYFRMGDVLEDHKRHRFSENLRHFSYLRGGYDGLKMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLYMLFKLQRLRVLSLRGYSIFHVpssigdlkhlQYLDLSETKIKTLPESVNKLWNLHTLLLENCHRLKKLCANMGSLIKLHHLKNSNVKALEEMPKGIGNLTHLLTLSRFVVGKDVGSGLRTLKLLKHLQgtldisklenvkdaSEAKEAQLIEKRNLLRLLLEWTsstsddpmehENVTLMLDGLKPHRNLEELTIRGYGGTTFPTWMGDSSFANLVLLRFEGCHRCTSLPSVGQLPLLKHLFIIEMTSVKMVGSEFYGNHCSVPFPSLETLCFQDIQEWEGWIPHGSGKEVNVFPQLRELSLIGCPKLQGRLPECLSSLERLVVRGCEQLTVLVSSLPKLCKLEIGGCKGMAWRSTNDVNRCCPQLLWLIAEEEQDQQQPVFPCSLQYLELSQCRYLVKLPQALLSLGFLREMEIYGNlikeesiqssSTRYTSLLEYLYIDDCASLTSLLPKNELPATLEHLHVKSCGNLAFLSLVGNLPKALKYLSVDHCLKLKSLAERLDNNSSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNLISFPDGGFLSSTLTKLWIYECEKLKALPNGMHNLTSLQELEIGDLPSMVYFPEDGFPTNLHSLEIRDMKMWKSLIEWEPLNRFTSLRRLSIHGCQDMVSFPQDNIGMMLPASLTKLEIVRFSNLEYLSSVGESLPSLECLILDDCPKLRYFPDKGLPPSLLQLHISNCPLIEESCRKDGGQYWHLISDIPCVYINFRCVFDVSD

MEDLGRKFFRDLHAKSFFQQSSCDTSRFVMHHLINDLAQWAAGDIYFRMGDVLEDHKRHRFSENLRHFSYLRGGYDGLKMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLYMLFKLQRLRVLSLRGYSIFHVPSSIGDLKHLQYLDLSETKIKTLPESVNKLWNLHTLLLENCHRLKKLCANMGSLIKLHHLKNSNVKALEEMPKGIGNLTHLLTLSRFVVGKDVGSGLRTLKLLKHLQGTLDISKLENVKDASEAKEAQLIEKRNllrlllEWTSSTSDDPMEHENVTLMLDGLKPHRNLEELTIRGYGGTTFPTWMGDSSFANLVLLRFEGCHRCTSLPSVGQLPLLKHLFIIEMTSVKMVGSEFYGNHCSVPFPSLETLCFQDIQEWEGWIPHGSGKEVNVFPQLRELSLIGCPKLQGRLPECLSSLERLVVRGCEQLTVLVSSLPKLCKLEIGGCKGMAWRSTNDVNRCCPQLLWLIAEEEQDQQQPVFPCSLQYLELSQCRYLVKLPQALLSLGFLREMEIYGNLIKEESIQSSSTRYTSLLEYLYIDDCASLTSLLPKNELPATLEHLHVKSCGNLAFLSLVGNLPKALKYLSVDHCLKLKSLAERLDNNSSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNLISFPDGGFLSSTLTKLWIYECEKLKALPNGMHNLTSLQELEIGDLPSMVYFPEDGFPTNLHSLEIRDMKMWKSLIEWEPLNRFTSLRRLSIHGCQDMVSFPQDNIGMMLPASLTKLEIVRFSNLEYLSSVGESLPSLECLILDDCPKLRYFPDKGLPPSLLQLHISNCPLIEESCRKDGGQYWHLISDIPCVYINFRCVFDVSD

*******FFRDLHAKSFFQQSSCDTSRFVMHHLINDLAQWAAGDIYFRMGDVLEDHKRHRFSENLRHFSYLRGGYDGLKMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLYMLFKLQRLRVLSLRGYSIFHVPSSIGDLKHLQYLDLSETKIKTLPESVNKLWNLHTLLLENCHRLKKLCANMGSLIKLHHLKNSNVKALEEMPKGIGNLTHLLTLSRFVVGKDVGSGLRTLKLLKHLQGTLDISKLEN**********QLIEKRNLLRLLLEWT************VTLMLDGLKPHRNLEELTIRGYGGTTFPTWMGDSSFANLVLLRFEGCHRCTSLPSVGQLPLLKHLFIIEMTSVKMVGSEFYGNHCSVPFPSLETLCFQDIQEWEGWIPHGSGKEVNVFPQLRELSLIGCPKLQGRLPECLSSLERLVVRGCEQLTVLVSSLPKLCKLEIGGCKGMAWRSTNDVNRCCPQLLWLIAEEEQDQQQPVFPCSLQYLELSQCRYLVKLPQALLSLGFLREMEIYGNLIKEESIQSSSTRYTSLLEYLYIDDCASLTSLLPKNELPATLEHLHVKSCGNLAFLSLVGNLPKALKYLSVDHCLKLKSLAERLDNNSSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNLISFPDGGFLSSTLTKLWIYECEKLKALPNGMHNLTSLQELEIGDLPSMVYFPEDGFPTNLHSLEIRDMKMWKSLIEWEPLNRFTSLRRLSIHGCQDMVSFPQDNIGMMLPASLTKLEIVRFSNLEYLSSVGESLPSLECLILDDCPKLRYFPDKGLPPSLLQLHISNCPLIEESCRKDGGQYWHLISDIPCVYINFRCVFDV**

MEDLGRKFFRDLHAKSFFQQSSCDTSRFVMHHLINDLAQWAAGDIYFRMGDVLE*****RFSENLRHFSYLRGGYDGLKMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLYMLFKLQRLRVLSLRGYSIFHVPSSIGDLKHLQYLDLSETKIKTLPESVNKLWNLHTLLLENCHRLKKLCANMGSLIKLHHLKNSNVKALEEMPKGIGNLTHLLTLSRFVVGKDVGSGLRTLKLLKHLQGTLDISKLENVKDASEAKEAQLIEKRNLLRLLLEWTSSTSD****HENVTLMLDGLKPHRNLEELTIRGYGGTTFPTWMGDSSFANLVLLRFEGCHRCTSLPSVGQLPLLKHLFIIEMTSVKMVGSEFYGNHCSVPFPSLETLCFQDIQEWEGWIPHGSGKEVNVFPQLRELSLIGCPKLQGRLPECLSSLERLVVRGCEQLTVLVSSLPKLCKLEIGGCKGMAWRSTNDVNRCCPQLLWLIAEEEQDQQQPVFPCSLQYLELSQCRYLVKLPQALLSLGFLREMEIYGNLIKE*********YTSLLEYLYIDDCASLTSLLPKNELPATLEHLHVKSCGNLAFLSLVGNLPKALKYLSVDHCLKLKSLAERLDNNSSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNLISFPDGGFLSSTLTKLWIYECEKLKALPNGMHNLTSLQELEIGDLPSMVYFPEDGFPTNLHSLEIRDMKMWKSLIE**PLNRFTSLRRLSIHGCQDMVSFPQDNIGMMLPASLTKLEIVRFSNLEYLSSVGESLPSLECLILDDCPKLRYFPDKGLPPSLLQLHISNCPLIEESCRKDGGQYWHLISDIPCVYINFRCVFDV**

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEDLGRKFFRDLHAKSFFQQSSCDTSRFVMHHLINDLAQWAAGDIYFRMGDVLEDHKRHRFSENLRHFSYLRGGYDGLKMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLYMLFKLQRLRVLSLRGYSIFHVPSSIGDLKHLQYLDLSETKIKTLPESVNKLWNLHTLLLENCHRLKKLCANMGSLIKLHHLKNSNVKALEEMPKGIGNLTHLLTLSRFVVGKDVGSGLRTLKLLKHLQGTLDxxxxxxxxxxxxxxxxxxxxxRNLLRLLLEWTSSTSDDPMEHENVTLMLDGLKPHRNLEELTIRGYGGTTFPTWMGDSSFANLVLLRFEGCHRCTSLPSVGQLPLLKHLFIIEMTSVKMVGSEFYGNHCSVPFPSLETLCFQDIQEWEGWIPHGSGKEVNVFPQLRELSLIGCPKLQGRLPECLSSLERLVVRGCEQLTVLVSSLPKLCKLEIGGCKGMAWRSTNDVNRCCPQLLWLIAEEEQDQQQPVFPCSLQYLELSQCRYLVKLPQALLSLGFLREMEIYGNLIKEESIQSSSTRYTSLLEYLYIDDCASLTSLLPKNELPATLEHLHVKSCGNLAFLSLVGNLPKALKYLSVDHCLKLKSLAERLDNNSSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNLISFPDGGFLSSTLTKLWIYECEKLKALPNGMHNLTSLQELEIGDLPSMVYFPEDGFPTNLHSLEIRDMKMWKSLIEWEPLNRFTSLRRLSIHGCQDMVSFPQDNIGMMLPASLTKLEIVRFSNLEYLSSVGESLPSLECLILDDCPKLRYFPDKGLPPSLLQLHISNCPLIEESCRKDGGQYWHLISDIPCVYINFRCVFDVSD

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		861	2.2.26 [Sep-21-2011]
Q9LRR5		1424	Putative disease resistan	yes	no	0.909	0.549	0.337	2e-86
Q9LRR4		1054	Putative disease resistan	no	no	0.621	0.507	0.323	2e-73
Q7XA42		979	Putative disease resistan	N/A	no	0.571	0.502	0.312	3e-46
Q7XA39		988	Putative disease resistan	N/A	no	0.579	0.505	0.295	8e-41
Q7XA40		992	Putative disease resistan	N/A	no	0.600	0.521	0.307	1e-39
Q7XBQ9		970	Disease resistance protei	N/A	no	0.578	0.513	0.296	5e-38
O23530		1301	Protein SUPPRESSOR OF npr	no	no	0.505	0.334	0.261	2e-12
Q38834		852	Disease resistance RPP13-	no	no	0.371	0.375	0.273	5e-10
P23799		630	Putative adenylate cyclas	N/A	no	0.281	0.384	0.296	8e-07
Q5ZLN0		603	Leucine-rich repeat-conta	yes	no	0.182	0.260	0.341	1e-06

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function desciption

 Score =  321 bits (822), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 297/881 (33%), Positives = 417/881 (47%), Gaps = 98/881 (11%)

Query: 1    MEDLGRKFFRDLHAKSFFQQSSCDTSRFVMHHLINDLAQWAAGDIYFRMGDVLEDHKRHR 60
            +ED+G  +  DL A+SFFQ+     + FVMH L+NDLA+  +GD  FR    LED     
Sbjct: 458  LEDIGNDYLGDLVAQSFFQRLDITMTSFVMHDLMNDLAKAVSGDFCFR----LEDDNIPE 513

Query: 61   FSENLRHFSYLRGGYDGLKMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLY-MLFKL 119
                 RHFS+ R   D    F  +  A+ LRT LP   S T      L   VL  +L  L
Sbjct: 514  IPSTTRHFSFSRSQCDASVAFRSICGAEFLRTILPFN-SPTSLESLQLTEKVLNPLLNAL 572

Query: 120  QRLRVLSLRGYSIFHVPSSIGDLKHLQYLDLSETKIKTLPESVNKLWNLHTLLLENCHRL 179
              LR+LSL  Y I ++P S+  LK L+YLDLS TKIK LPE V  L NL TLLL NC  L
Sbjct: 573  SGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDL 632

Query: 180  KKLCANMGSLIKLHHLKNSNVKALEEMPKGIGNLTHLLTLSRFVVGKDVGSGLRTLKLLK 239
              L  ++  LI L  L       L EMP GI  L  L  LS FV+G+  G+GL  LK L 
Sbjct: 633  TSLPKSIAELINLRLLDLVGT-PLVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELS 691

Query: 240  HLQGTLDISKLENVKDASEAKEAQLIEKRNLLRLLLEWTSSTSDDPMEHENVTL-----M 294
            HL+GTL IS+L+NV  ASEAK+A L  K  L  L+L+WT   S       N        +
Sbjct: 692  HLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALACDQKEV 751

Query: 295  LDGLKPHRNLEELTIRGYGGTTFPTWMGDSSFANLVLLRFEGCHRCTSLPSVGQLPLLKH 354
            L  L+PH +L+   I  Y G  FP W+GDSSF  +  +    C+ C SLP VGQLP LK+
Sbjct: 752  LRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKY 811

Query: 355  LFIIEMTSVKMVGSEFY---GNHCSVPFPSLETLCFQDIQEWEGWI-PHGSGKEVNVFPQ 410
            L I +   ++ VG +F+    N   VPF SL+ L F  +  W+ WI P     E  +FP 
Sbjct: 812  LSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWICPE---LEDGIFPC 868

Query: 411  LRELSLIGCPKLQGRLPECLSSLERLVVRGCEQLTV----------------LVSSLPKL 454
            L++L +  CP L+ + PE L S   + +  C    V                  +S+P +
Sbjct: 869  LQKLIIQRCPSLRKKFPEGLPSSTEVTISDCPLRAVSGGENSFRRSLTNIPESPASIPSM 928

Query: 455  CKLEIGGCKGMAWRSTNDVNRCCPQLLWLIAEEEQDQQQPVFPCSLQY---LELSQCRYL 511
             + E+    G                      +     QP F  S Q     E++    L
Sbjct: 929  SRRELSSPTGNP------------------KSDASTSAQPGFASSSQSNDDNEVTSTSSL 970

Query: 512  VKLPQALLSLGFLREMEIYGNLIKE-ESIQSSSTRYTSLLEYLYIDDCASL-------TS 563
              LP+   +  F +     G+L ++ E     S RY+      YI D  S        TS
Sbjct: 971  SSLPKDRQTEDFDQYETQLGSLPQQFEEPAVISARYSG-----YISDIPSTLSPYMSRTS 1025

Query: 564  LL--PKNE---LPATLEHLHVKSCGNLAFLSLVGNLPKALKYLSVD------HCLKLKSL 612
            L+  PKNE   LP +  + + +     +  S   +  +A+K    D        LK+  +
Sbjct: 1026 LVPDPKNEGSILPGSSSYQYHQYGIKSSVPSPRSS--EAIKPSQYDDDETDMEYLKVTDI 1083

Query: 613  AERLDNNSSLEAVKISYCENLIVLPDGLLK-LNHLQEIFISHCPNLISFPDGGFLSSTLT 671
            +  ++   +L+++ I  C+ L  LP+ L +   +L E+ I  C +L SFP G    +TL 
Sbjct: 1084 SHLMELPQNLQSLHIDSCDGLTSLPENLTESYPNLHELLIIACHSLESFP-GSHPPTTLK 1142

Query: 672  KLWIYECEKLKALPN--GMHNLTSLQELEIG-DLPSMVYFPEDGFPTNLHSLEIRDMKMW 728
             L+I +C+KL    +     + + L+ L IG    ++V FP   FP  L SL IRD + +
Sbjct: 1143 TLYIRDCKKLNFTESLQPTRSYSQLEYLFIGSSCSNLVNFPLSLFP-KLRSLSIRDCESF 1201

Query: 729  KSL-IEWEPLNRFTSLRRLSIHGCQDMVSFPQDNIGMMLPASLTKLEIVRFSNLEYLSSV 787
            K+  I     +   +L  L I  C ++ +FPQ   G+  P    KL  +  SN + L ++
Sbjct: 1202 KTFSIHAGLGDDRIALESLEIRDCPNLETFPQG--GLPTP----KLSSMLLSNCKKLQAL 1255

Query: 788  GE---SLPSLECLILDDCPKLRYFPDKGLPPSLLQLHISNC 825
             E    L SL  L +  CP++   P  G P +L  L IS C
Sbjct: 1256 PEKLFGLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCISLC 1296

Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9LRR4\|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1	Back alignment and function description

>sp\|Q7XA42\|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2	Back alignment and function description

>sp\|Q7XA39\|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1	Back alignment and function description

>sp\|Q7XA40\|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2	Back alignment and function description

>sp\|Q7XBQ9\|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1	Back alignment and function description

>sp\|O23530\|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3	Back alignment and function description

>sp\|Q38834\|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2	Back alignment and function description

>sp\|P23799\|ESAG8_TRYBB Putative adenylate cyclase regulatory protein OS=Trypanosoma brucei brucei GN=ESAG8 PE=2 SV=1	Back alignment and function description

>sp\|Q5ZLN0\|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		861
356554923		1399	PREDICTED: putative disease resistance R	0.982	0.604	0.399	1e-163
284026888		1424	CC-NBS-LRR protein [Quercus suber]	0.984	0.595	0.398	1e-157
400131587		1388	FB_MR5 [Malus x robusta]	0.975	0.605	0.404	1e-154
147825318		1824	hypothetical protein VITISV_003723 [Viti	0.946	0.446	0.407	1e-146
225449959		1350	PREDICTED: putative disease resistance p	0.948	0.605	0.399	1e-144
224059590		1381	cc-nbs-lrr resistance protein [Populus t	0.969	0.604	0.380	1e-141
225449649		1418	PREDICTED: putative disease resistance p	0.958	0.581	0.383	1e-140
147775060		1330	hypothetical protein VITISV_014782 [Viti	0.952	0.616	0.398	1e-140
147846228		1372	hypothetical protein VITISV_006043 [Viti	0.969	0.608	0.398	1e-139
225449872		1322	PREDICTED: putative disease resistance p	0.951	0.619	0.400	1e-138

>gi\|356554923\|ref\|XP_003545790.1\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max]	Back alignment and taxonomy information

 Score =  583 bits (1504), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 377/943 (39%), Positives = 539/943 (57%), Gaps = 97/943 (10%)

Query: 1    MEDLGRKFFRDLHAKSFFQQSSCDTSRFVMHHLINDLAQWAAGDIYFRMGDVLEDHKRHR 60
            MED+G ++F++L + S FQ+SS + S +VMH LINDLAQW AG+  F++ +  + HK+ +
Sbjct: 464  MEDVGHEYFQELLSASLFQKSSSNRSLYVMHDLINDLAQWVAGESCFKLDNNFQSHKQKK 523

Query: 61   FSENL--RHFSYLRGGYDGLKMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLYMLFK 118
               +   R+ SY+ G YDG++MF+   +AK LRTFLPL             H    +L +
Sbjct: 524  KKISKMTRYASYVGGEYDGIQMFQAFKEAKSLRTFLPLKHRRLEEWSYITNHVPFELLPE 583

Query: 119  LQRLRVLSLRGYSIFHVPSSIGDLKHLQYLDLSETKIKTLPESVNKLWNLHTLLLENCHR 178
            L+ LR LSL GY I  +P+S+ +L  L+YL+LS T ++ LPES+  L NL TLLL +C  
Sbjct: 584  LRCLRALSLSGYFISKLPNSVSNLNLLRYLNLSSTDLRQLPESICSLCNLQTLLLRDCFN 643

Query: 179  LKKLCANMGSLIKLHHLKNSNVKALEEMPKGIGNLTHLLTLSRFVVGKDVGSGLRTLKLL 238
            L++L +NM  LI L HL  +   +L  MP GIG LTHL TLS FVVG    SG+  L  L
Sbjct: 644  LEELPSNMSDLINLRHLDITRSHSLTRMPHGIGKLTHLQTLSNFVVG---SSGIGELMKL 700

Query: 239  KHLQGTLDISKLENVKDASEAKEAQLIEKRNLLRLLLEWTSSTSDDPMEHENVTLMLDGL 298
             +++G L +S+LE+V D  EA EA + +K  +  L L+WTS  ++     E    +L  L
Sbjct: 701  SNIRGVLSVSRLEHVTDTREASEAMINKKVGIDVLKLKWTSCMNNQS-HTERAKEVLQML 759

Query: 299  KPHRNLEELTIRGYGGTTFPTWMGDSSFANLVLLRFEGCHRCTSLPSVGQLPLLKHLFII 358
            +PH+NL +LTI+ YGGT+FP W+GD S+ +LV L+ + C  CTSLP++G L  LK L+II
Sbjct: 760  QPHKNLAKLTIKCYGGTSFPKWIGDPSYKSLVFLKLKDCAHCTSLPALGNLHALKELYII 819

Query: 359  EMTSVKMVGSEFYGNHCSVPFPSLETLCFQDIQEWEGWIPHGSGKEVNVFPQLRELSLIG 418
             M  V  +  EF GN C  PFPSLE L F D+++WE W    + ++ ++F  L++L ++ 
Sbjct: 820  GMKEVCCIDGEFCGNACLRPFPSLERLYFMDMEKWENWFLSDNNEQNDMFSSLQQLFIVK 879

Query: 419  CPKLQGRLPECLSSLERLVVRGCEQLTVLVSSLPKLCKLEIGGCKGMAWRSTNDVNRCCP 478
            CPKL G+LPE L SL+ ++V+ CEQL V +SSLP L KLEI GCKG+     N+ N    
Sbjct: 880  CPKLLGKLPENLPSLKHVIVKECEQLLVTISSLPVLYKLEIEGCKGLVLNCANEFNSLNS 939

Query: 479  Q-----------LLWLIAEEEQDQQQPVFPCSLQYLELSQC----RYLVKLPQALLSLGF 523
                        +  L+   +  ++  +  C+L    L+       +L K P  L S+  
Sbjct: 940  MSVSRILEFTFLMERLVQAFKTVEELKIVSCALDETVLNDLWVNEVWLEKNPHGLSSI-- 997

Query: 524  LREMEIYG-NLIKEESIQSSSTRYTSLLEYLYIDDCASLTSLLPKNELPATLEHLHVKSC 582
            LR +EI   N++K  SI       +  LE LYI  C S+   +  ++LP +L+ L + +C
Sbjct: 998  LRLIEIRNCNIMK--SIPKVLMVNSHFLERLYICHCDSIV-FVTMDQLPHSLKSLEISNC 1054

Query: 583  GNLAFL------------------------------------------SLVGNLPKALKY 600
             NL  L                                          S  G LP+++K+
Sbjct: 1055 KNLRCLLDNGTCTSSSIIMHDDNVQHGSTIISHLEYVYIGWCPSLTCISRSGELPESVKH 1114

Query: 601  ------------------------LSVDHCLKLKSLAERLDNNSSLEAVKISYCENLIVL 636
                                    L +  C KL+S+A RL  N+SLE+++I  CENL  L
Sbjct: 1115 LFIWNCSELSCLSMKGQLPKSIERLEIQSCPKLESIANRLHRNTSLESIQIWNCENLKSL 1174

Query: 637  PDGLLKLNHLQEIFISHCPNLISFPDGGFLSSTLTKLWIYECEKLKALPNGMHNLTSLQE 696
            P+GL  L +L+EI I  CPNL+SFP+ G  +S+L++L I  CEKL ALPN M+NL SL+E
Sbjct: 1175 PEGLHFLVNLKEIKIIGCPNLVSFPEEGLPASSLSELSIMSCEKLVALPNSMYNLDSLKE 1234

Query: 697  LEIGDLPSMVYFPEDGFPTNLHSLEIRDMKMWKSLIEWEPLNRFTSLRRLSIHGCQDMVS 756
            LEIG  PS+ YFPE  FP NL SL I D    +++  W  L + + LR L+I G    + 
Sbjct: 1235 LEIGYCPSIQYFPEINFPDNLTSLWINDHNACEAMFNW-GLYKLSFLRDLTIIGGN--LF 1291

Query: 757  FPQDNIGMMLPASLTKLEIVRFSNLEYLSSVG-ESLPSLECLILDDCPKLRYFPDKGLPP 815
             P + +G MLP++LT L +  F +LE LSS G   L SL  L + +CPKL   P+KGLP 
Sbjct: 1292 MPLEKLGTMLPSTLTSLTVQGFPHLENLSSEGFHKLTSLSKLSIYNCPKLLCLPEKGLPS 1351

Query: 816  SLLQLHISNCPLIEESCRKDGGQYWHLISDIPCVYINFRCVFD 858
            SLL+L+I +CP ++E CRKD G+ W  I+D+P V I+ + ++D
Sbjct: 1352 SLLELYIQDCPFLKEQCRKDKGRDWLKIADVPYVEIDGKFIYD 1394

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|284026888\|gb\|ADB66335.1\| CC-NBS-LRR protein [Quercus suber]	Back alignment and taxonomy information

>gi\|400131587\|emb\|CCH50986.1\| FB_MR5 [Malus x robusta]	Back alignment and taxonomy information

>gi\|147825318\|emb\|CAN73260.1\| hypothetical protein VITISV_003723 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225449959\|ref\|XP_002271030.1\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224059590\|ref\|XP_002299922.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222847180\|gb\|EEE84727.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225449649\|ref\|XP_002262753.1\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147775060\|emb\|CAN77204.1\| hypothetical protein VITISV_014782 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147846228\|emb\|CAN81660.1\| hypothetical protein VITISV_006043 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225449872\|ref\|XP_002265429.1\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		861
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.501	0.303	0.410	3.6e-102
TAIR\|locus:2091672		1054	AT3G14470 [Arabidopsis thalian	0.500	0.408	0.378	1.3e-76
UNIPROTKB\|O48647		1802	O48647 "XA1" [Oryza sativa (ta	0.817	0.390	0.262	7.6e-15
TAIR\|locus:2094498		1981	AT3G25510 [Arabidopsis thalian	0.370	0.161	0.269	1.6e-19
TAIR\|locus:2053405		1215	AT2G14080 [Arabidopsis thalian	0.442	0.313	0.266	1.6e-18
TAIR\|locus:2163426		1187	TAO1 "target of AVRB operation	0.371	0.269	0.276	2.6e-18
TAIR\|locus:2205824		1384	AT1G27170 [Arabidopsis thalian	0.585	0.364	0.25	2.5e-11
TAIR\|locus:2147992		1189	AT5G11250 [Arabidopsis thalian	0.275	0.199	0.281	3.9e-13
TAIR\|locus:2076043		1194	RPP1 "recognition of peronospo	0.340	0.245	0.273	2.7e-15
TAIR\|locus:2098110		1219	AT3G44670 [Arabidopsis thalian	0.318	0.224	0.275	1.4e-12

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 711 (255.3 bits), Expect = 3.6e-102, Sum P(2) = 3.6e-102
 Identities = 185/451 (41%), Positives = 237/451 (52%)

Query:     1 MEDLGRKFFRDLHAKSFFQQSSCDTSRFVMHHLINDLAQWAAGDIYFRMGDVLEDHKRHR 60
             +ED+G  +  DL A+SFFQ+     + FVMH L+NDLA+  +GD  FR    LED     
Sbjct:   458 LEDIGNDYLGDLVAQSFFQRLDITMTSFVMHDLMNDLAKAVSGDFCFR----LEDDNIPE 513

Query:    61 FSENLRHFSYLRGGYDGLKMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLYMLFK-L 119
                  RHFS+ R   D    F  +  A+ LRT LP   S T      L   VL  L   L
Sbjct:   514 IPSTTRHFSFSRSQCDASVAFRSICGAEFLRTILPFN-SPTSLESLQLTEKVLNPLLNAL 572

Query:   120 QRLRVLSLRGYSIFHVPSSIGDLKHLQYLDLSETKIKTLPESVNKLWNLHTLLLENCHRL 179
               LR+LSL  Y I ++P S+  LK L+YLDLS TKIK LPE V  L NL TLLL NC  L
Sbjct:   573 SGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDL 632

Query:   180 KKLCANMGSLIKLHHLKNSNVKALEEMPKGIGNLTHLLTLSRFVVGKDVGSGLRTLKLLK 239
               L  ++  LI L  L       L EMP GI  L  L  LS FV+G+  G+GL  LK L 
Sbjct:   633 TSLPKSIAELINLRLLDLVGTP-LVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELS 691

Query:   240 HLQGTLDISKLENVKDASEAKEAQLIEKRNXXXXXXEWTSSTSDDPMEHENVTL-----M 294
             HL+GTL IS+L+NV  ASEAK+A L  K        +WT   S       N        +
Sbjct:   692 HLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALACDQKEV 751

Query:   295 LDGLKPHRNLEELTIRGYGGTTFPTWMGDSSFANLVLLRFEGCHRCTSLPSVGQLPLLKH 354
             L  L+PH +L+   I  Y G  FP W+GDSSF  +  +    C+ C SLP VGQLP LK+
Sbjct:   752 LRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKY 811

Query:   355 LFIIEMTSVKMVGSEFY---GNHCSVPFPSLETLCFQDIQEWEGWI-PHGSGKEVNVFPQ 410
             L I +   ++ VG +F+    N   VPF SL+ L F  +  W+ WI P     E  +FP 
Sbjct:   812 LSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWICPE---LEDGIFPC 868

Query:   411 LRELSLIGCPKLQGRLPECLSSLERLVVRGC 441
             L++L +  CP L+ + PE L S   + +  C
Sbjct:   869 LQKLIIQRCPSLRKKFPEGLPSSTEVTISDC 899

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)]	Back alignment and assigned GO terms

TAIR\|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2076043 RPP1 "recognition of peronospora parasitica 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00028671001	SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (1141 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		861
PLN03210		1153	PLN03210, PLN03210, Resistant to P	2e-13
PRK15386		426	PRK15386, PRK15386, type III secretion protein Gog	4e-04
PLN03210		1153	PLN03210, PLN03210, Resistant to P	6e-04
PLN03210		1153	PLN03210, PLN03210, Resistant to P	6e-04
PLN03210		1153	PLN03210, PLN03210, Resistant to P	0.001
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	0.001
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	0.002

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score = 74.5 bits (183), Expect = 2e-13
 Identities = 65/195 (33%), Positives = 97/195 (49%), Gaps = 12/195 (6%)

Query: 620 SSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNLISFPDGGFLSSTLTKLWIYECE 679
           ++LE +K+S C +L+ LP  +  LN L+++ +S C NL   P G  L S L +L +  C 
Sbjct: 657 TNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKS-LYRLNLSGCS 715

Query: 680 KLKALPNGMHNLTSL--QELEIGDLPSMVYFPEDGFPTNLHSLEIRDMKMWKSLIEWEPL 737
           +LK+ P+   N++ L   E  I + PS +   E+     L   E++  K+W+ +    PL
Sbjct: 716 RLKSFPDISTNISWLDLDETAIEEFPSNLRL-ENLD--ELILCEMKSEKLWERVQPLTPL 772

Query: 738 NRFT--SLRRLSIHGCQDMVSFPQDNIGMMLPASLTKLEIVRFSNLEYLSSVGESLPSLE 795
                 SL RL +     +V  P     +     L  LEI    NLE L + G +L SLE
Sbjct: 773 MTMLSPSLTRLFLSDIPSLVELPSSIQNL---HKLEHLEIENCINLETLPT-GINLESLE 828

Query: 796 CLILDDCPKLRYFPD 810
            L L  C +LR FPD
Sbjct: 829 SLDLSGCSRLRTFPD 843

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		861
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.97
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.96
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.95
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.95
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.94
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.93
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.92
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.92
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.92
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.9
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.89
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.72
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.63
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.62
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.6
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.54
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.49
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.48
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.47
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.39
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.18
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.15
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.95
KOG4341		483	consensus F-box protein containing LRR [General fu	98.9
KOG4341		483	consensus F-box protein containing LRR [General fu	98.86
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.74
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.7
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.68
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.66
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.65
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.6
PLN03150		623	hypothetical protein; Provisional	98.6
PRK15386		426	type III secretion protein GogB; Provisional	98.55
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.54
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.54
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.53
PLN03150		623	hypothetical protein; Provisional	98.47
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.46
PRK15386		426	type III secretion protein GogB; Provisional	98.4
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.4
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.35
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.25
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.18
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.15
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.09
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.06
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.94
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.92
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.74
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.73
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.72
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.65
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.5
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.49
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.34
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.27
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.22
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.15
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.93
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.84
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.7
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	96.69
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.67
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.25
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	96.2
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.06
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.62
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	95.4
KOG0473		326	consensus Leucine-rich repeat protein [Function un	95.36
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.97
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	94.93
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.65
KOG3864		221	consensus Uncharacterized conserved protein [Funct	94.08
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.81
KOG0473		326	consensus Leucine-rich repeat protein [Function un	92.96
smart00370		26	LRR Leucine-rich repeats, outliers.	91.99
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	91.99
KOG3864		221	consensus Uncharacterized conserved protein [Funct	91.91
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	87.52
smart00370		26	LRR Leucine-rich repeats, outliers.	87.52

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Probab=100.00  E-value=1.9e-43  Score=431.09  Aligned_cols=533  Identities=19%  Similarity=0.174  Sum_probs=335.5

Q ss_pred             CCceeEEEEEecCCCccchhhhhcccCCccEEeecccccCcCCcccchhhhhhc-cCCCCcccEEEccCccccc-cCccc
Q 038705           62 SENLRHFSYLRGGYDGLKMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLYM-LFKLQRLRVLSLRGYSIFH-VPSSI  139 (861)
Q Consensus        62 ~~~~~~lsl~~~~~~~~~~~~~~~~~~~Lr~L~l~~~~~~~~~~~~~~~~~~~~-~~~l~~L~~L~L~~~~i~~-lp~~~  139 (861)
                      ..+++.+++.++.+... ....+..+++||+|.+.++.        +...+|.+ |..+++||+|+|++|.++. +|.  
T Consensus        68 ~~~v~~L~L~~~~i~~~-~~~~~~~l~~L~~L~Ls~n~--------~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--  136 (968)
T PLN00113         68 SSRVVSIDLSGKNISGK-ISSAIFRLPYIQTINLSNNQ--------LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--  136 (968)
T ss_pred             CCcEEEEEecCCCcccc-CChHHhCCCCCCEEECCCCc--------cCCcCChHHhccCCCCCEEECcCCccccccCc--
Confidence            45789999988876543 24678889999999886543        44578888 7799999999999999874 454  


Q ss_pred             CCCCccceeeccCCccc-ccchhhhccccccEEecCCccchhhchhhhhhccccceeecCCCcccccCcccccccccccc
Q 038705          140 GDLKHLQYLDLSETKIK-TLPESVNKLWNLHTLLLENCHRLKKLCANMGSLIKLHHLKNSNVKALEEMPKGIGNLTHLLT  218 (861)
Q Consensus       140 ~~L~~L~~L~Ls~~~i~-~lp~~i~~L~~L~~L~l~~n~~~~~lp~~~~~L~~L~~L~l~~~~~~~~~p~~i~~l~~L~~  218 (861)
                      +.+++|++|+|++|.+. .+|..|+++++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..++++++|++
T Consensus       137 ~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~  216 (968)
T PLN00113        137 GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKW  216 (968)
T ss_pred             cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccE
Confidence            56899999999999987 78888999999999999999888899999999999999999999988888999999999998


Q ss_pred             ccceEecccCCCCcccccccccccceeeecCccCCCChhHHHHHhhhcccCcchhheeeccCCCCCCcchhhHHHhhccc
Q 038705          219 LSRFVVGKDVGSGLRTLKLLKHLQGTLDISKLENVKDASEAKEAQLIEKRNLLRLLLEWTSSTSDDPMEHENVTLMLDGL  298 (861)
Q Consensus       219 L~~~~~~~~~~~~~~~l~~l~~L~~~l~~~~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~l  298 (861)
                      |++..+...                              ...+..+..+.+|+.|++++|...+..          ...+
T Consensus       217 L~L~~n~l~------------------------------~~~p~~l~~l~~L~~L~L~~n~l~~~~----------p~~l  256 (968)
T PLN00113        217 IYLGYNNLS------------------------------GEIPYEIGGLTSLNHLDLVYNNLTGPI----------PSSL  256 (968)
T ss_pred             EECcCCccC------------------------------CcCChhHhcCCCCCEEECcCceecccc----------ChhH
Confidence            865443211                              011112344455555555554432211          1223


Q ss_pred             CCCCCccEEEEeecCCC-CCCcCCCCCCcCCeeEEEEeCCCCCCCCC-CCCCCCCcceeeeccccceeEECccccCCcCc
Q 038705          299 KPHRNLEELTIRGYGGT-TFPTWMGDSSFANLVLLRFEGCHRCTSLP-SVGQLPLLKHLFIIEMTSVKMVGSEFYGNHCS  376 (861)
Q Consensus       299 ~~~~~L~~L~l~~~~~~-~~p~~~~~~~~~~L~~L~L~~~~~~~~~~-~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~  376 (861)
                      ..+++|+.|++++|... .+|.++.  .+++|+.|++++|.+.+.+| .+..+++|+.|++++|.....++..+..    
T Consensus       257 ~~l~~L~~L~L~~n~l~~~~p~~l~--~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~----  330 (968)
T PLN00113        257 GNLKNLQYLFLYQNKLSGPIPPSIF--SLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTS----  330 (968)
T ss_pred             hCCCCCCEEECcCCeeeccCchhHh--hccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhc----
Confidence            44455555555555432 3444442  25556666666665555555 4555556666666555433333222211    


Q ss_pred             CCCCCcceEeccccccccccccCCCCCcccccCccceEeccCCCCCcCCCCCCCCCcceEEEeccCCCcccCCCCCccce
Q 038705          377 VPFPSLETLCFQDIQEWEGWIPHGSGKEVNVFPQLRELSLIGCPKLQGRLPECLSSLERLVVRGCEQLTVLVSSLPKLCK  456 (861)
Q Consensus       377 ~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~p~~l~~L~~L~l~~~~~l~~~~~~~~~L~~  456 (861)
                        +++|+.|++++ +.+.+..+..+..    +++|+.|++++ +.+.+.+|..                  +..+++|+.
T Consensus       331 --l~~L~~L~L~~-n~l~~~~p~~l~~----~~~L~~L~Ls~-n~l~~~~p~~------------------~~~~~~L~~  384 (968)
T PLN00113        331 --LPRLQVLQLWS-NKFSGEIPKNLGK----HNNLTVLDLST-NNLTGEIPEG------------------LCSSGNLFK  384 (968)
T ss_pred             --CCCCCEEECcC-CCCcCcCChHHhC----CCCCcEEECCC-CeeEeeCChh------------------HhCcCCCCE
Confidence              44455555444 2333333322322    44455555554 2333333322                  112233333


Q ss_pred             EEEccCCCCcccccccccccccccchhhhhhhhhccCCCCCCcccEEEeecccccccchhhhhccccccEEEEecccccc
Q 038705          457 LEIGGCKGMAWRSTNDVNRCCPQLLWLIAEEEQDQQQPVFPCSLQYLELSQCRYLVKLPQALLSLGFLREMEIYGNLIKE  536 (861)
Q Consensus       457 L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~  536 (861)
                      +++++|......         +            ..+..+ ++|+.|++++|.+.+..|..+..+++|+.|++++|.  +
T Consensus       385 L~l~~n~l~~~~---------p------------~~~~~~-~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~--l  440 (968)
T PLN00113        385 LILFSNSLEGEI---------P------------KSLGAC-RSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNN--L  440 (968)
T ss_pred             EECcCCEecccC---------C------------HHHhCC-CCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCc--c
Confidence            333333211100         0            000011 255556666665555555555556666666666552  2


Q ss_pred             cccccccccCCCCccEEEecCCCCccccCCCCCCCCCccEEEEecCCCcccccccCCCcccCcEEeeccccCcchhhhhc
Q 038705          537 ESIQSSSTRYTSLLEYLYIDDCASLTSLLPKNELPATLEHLHVKSCGNLAFLSLVGNLPKALKYLSVDHCLKLKSLAERL  616 (861)
Q Consensus       537 ~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~  616 (861)
                      .......+..+++|+.|++++|                        .....+|..... ++|+.|++++|...+.+|..+
T Consensus       441 ~~~~~~~~~~l~~L~~L~L~~n------------------------~~~~~~p~~~~~-~~L~~L~ls~n~l~~~~~~~~  495 (968)
T PLN00113        441 QGRINSRKWDMPSLQMLSLARN------------------------KFFGGLPDSFGS-KRLENLDLSRNQFSGAVPRKL  495 (968)
T ss_pred             cCccChhhccCCCCcEEECcCc------------------------eeeeecCccccc-ccceEEECcCCccCCccChhh
Confidence            2112222234455555555555                        322222211112 368888888887777778888


Q ss_pred             cCCCCccEEeeccccCcccccccccCCCCCcEEeeccCCCceecCCCCCCcCCccEEEeccccCcccccccCCCCCccCE
Q 038705          617 DNNSSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNLISFPDGGFLSSTLTKLWIYECEKLKALPNGMHNLTSLQE  696 (861)
Q Consensus       617 ~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~  696 (861)
                      .++++|+.|++++|.+.+.+|..+.++++|++|++++|...+.+|..+..+++|+.|++++|++.+.+|..+.++++|+.
T Consensus       496 ~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~  575 (968)
T PLN00113        496 GSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQ  575 (968)
T ss_pred             hhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCE
Confidence            88888888888888888888888888888888888888877788888888888888888888888888888888888888


Q ss_pred             EeecCCCCCcccCCCCCCCCccEEEecCcc
Q 038705          697 LEIGDLPSMVYFPEDGFPTNLHSLEIRDMK  726 (861)
Q Consensus       697 L~l~~n~~l~~~~~~~~~~~L~~L~l~~~~  726 (861)
                      |++++|+....+|..+.+.++....+.+|+
T Consensus       576 l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~  605 (968)
T PLN00113        576 VNISHNHLHGSLPSTGAFLAINASAVAGNI  605 (968)
T ss_pred             EeccCCcceeeCCCcchhcccChhhhcCCc
Confidence            888888777777766555555555555554

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		861
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		4e-05

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

Iteration: 1

Score = 47.4 bits (111), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 55/211 (26%), Positives = 93/211 (44%), Gaps = 18/211 (8%) Query: 598 LKYLSVDHCLKLKSLAERLDNNSSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNL 657 L++ ++D L L + + LE + ++ L LP + LN L+E+ I CP L Sbjct: 106 LQHXTID-AAGLXELPDTXQQFAGLETLTLAR-NPLRALPASIASLNRLRELSIRACPEL 163 Query: 658 ISFP------DGGFLSSTLTKLWIYECE--KLKALPNGMHNLTSLQELEIGDLPSMVYFP 709 P D L L E +++LP + NL +L+ L+I + P P Sbjct: 164 TELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGP 223 Query: 710 EDGFPTNLHSLEIRDMKMWKSLIEWEPL-NRFTSLRRLSIHGCQDMVSFPQDNIGMMLPA 768 +L LE D++ +L + P+ L+RL + C ++++ P D + Sbjct: 224 AI---HHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLT--- 277 Query: 769 SLTKLEIVRFSNLEYLSSVGESLPSLECLIL 799 L KL++ NL L S+ LP+ C+IL Sbjct: 278 QLEKLDLRGCVNLSRLPSLIAQLPA-NCIIL 307

PyMOL of 4fcg

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		861
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-22
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-21
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-20
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-18
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-16
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-16
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-15
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-09
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-07
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-04
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-15
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-15
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	9e-13
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-10
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-08
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-07
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-12
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-06
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-12
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-04
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	8e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-11
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	8e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-11
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-11
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-05
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-11
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	6e-10
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	6e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	6e-11
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-10
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-10
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-04
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-10
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	5e-08
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-04
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-10
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	7e-06
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	8e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-10
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	6e-10
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	9e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	7e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-09
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-08
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	6e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	7e-05
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	5e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	6e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-06
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-04
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	8e-07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	9e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	6e-08
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	6e-07
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	8e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	8e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-05
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	7e-05
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	8e-04
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	6e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	6e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	9e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-07
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	4e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-07
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	8e-07
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-06
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-06
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	8e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	9e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-06
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	6e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-06
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-06
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	4e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	7e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	8e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	4e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-04
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	9e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	6e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	4e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-05
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-05
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-05
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	1e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	4e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	4e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	7e-05
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	1e-04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	1e-04
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	1e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	1e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	4e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	5e-04
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	4e-04
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	5e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	6e-04

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

 Score = 96.9 bits (242), Expect = 6e-22
 Identities = 62/325 (19%), Positives = 96/325 (29%), Gaps = 62/325 (19%)

Query: 411 LRELSLIGCPKLQGRLPECLSSLERLVVRGCEQLTVLVSSLPKLCKLEIGGCKGMAWRST 470
              L   G   L+    + LS  +R                      +I           
Sbjct: 14  RENLYFQGSTALR-PYHDVLSQWQRHYNA-DRNRWHSAWRQANSNNPQI----------- 60

Query: 471 NDVNRCCPQLLWLIAEEEQDQQQPVFPCSLQYLELSQCRYLVKLPQALLSLGFLREMEIY 530
               R    L       E   Q          LEL     L + P     L  L+ M I 
Sbjct: 61  --ETRTGRALKATADLLEDATQP-----GRVALELRSVP-LPQFPDQAFRLSHLQHMTID 112

Query: 531 GNLIKE--ESIQS---------SSTRYTSL---------LEYLYIDDCASLTSL---LPK 567
              + E  +++Q          +     +L         L  L I  C  LT L   L  
Sbjct: 113 AAGLMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLAS 172

Query: 568 NELPATLEHLHVKSCGNLAFLSLVGN----LP------KALKYLSVDHCLKLKSLAERLD 617
            +     + L      NL  L L       LP      + LK L + +   L +L   + 
Sbjct: 173 TDASGEHQGLV-----NLQSLRLEWTGIRSLPASIANLQNLKSLKIRNS-PLSALGPAIH 226

Query: 618 NNSSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNLISFPDG-GFLSSTLTKLWIY 676
           +   LE + +  C  L   P        L+ + +  C NL++ P     L+  L KL + 
Sbjct: 227 HLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQ-LEKLDLR 285

Query: 677 ECEKLKALPNGMHNLTSLQELEIGD 701
            C  L  LP+ +  L +   + +  
Sbjct: 286 GCVNLSRLPSLIAQLPANCIILVPP 310

PyMOL of 4fcg

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		861
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	100.0
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.98
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.97
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.97
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.97
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.97
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.96
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.95
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.95
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.95
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.94
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.94
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.93
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.92
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.92
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.92
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.92
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.92
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.91
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.91
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.89
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.89
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.89
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.89
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.89
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.88
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.86
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.85
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.84
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.84
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.84
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.83
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.82
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.82
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.82
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.81
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.81
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.81
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.81
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.81
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.81
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.8
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.8
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.8
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.78
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.78
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.78
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.76
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.76
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.75
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.75
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.74
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.74
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.73
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.73
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.71
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.7
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.7
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.69
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.69
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.67
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.67
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.67
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.66
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.65
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.64
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.63
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.63
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.63
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.63
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.6
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.57
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.56
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.54
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.54
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.53
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.52
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.51
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.5
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.49
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.47
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.47
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.46
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.45
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.45
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.44
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.43
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.41
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.4
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.4
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.39
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.38
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.38
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.37
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.36
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.36
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.35
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.35
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.34
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.32
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.32
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.29
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.28
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.26
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.24
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.21
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.21
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.2
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.19
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.18
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.18
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.17
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.14
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.11
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.1
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.07
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.07
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.05
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.99
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.93
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.9
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.85
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.76
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.75
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.54
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.52
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.48
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.41
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.37
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.22
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.22
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.14
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.13
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.13
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.09
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.06
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.99
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.92
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.91
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	97.09
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.63
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	94.85
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	94.67
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	93.76
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	90.99
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	83.2
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	82.13

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=3.8e-55  Score=518.82  Aligned_cols=665  Identities=16%  Similarity=0.084  Sum_probs=353.5

Q ss_pred             HHHHhccceEEecccccCccccCCCCceeEEEEEecCCCcc--chhhhhcccCCccEEeecccccCcCCcccchhhhhhc
Q 038705           38 AQWAAGDIYFRMGDVLEDHKRHRFSENLRHFSYLRGGYDGL--KMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLYM  115 (861)
Q Consensus        38 a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lsl~~~~~~~~--~~~~~~~~~~~Lr~L~l~~~~~~~~~~~~~~~~~~~~  115 (861)
                      +.|.+...|+.+.+.     .++ .++++.+++.+..+...  ...+++.++++|+.+.+..+.         ...+|+.
T Consensus        31 ~~W~~~~~~C~w~gv-----~C~-~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~---------~~~l~~~   95 (768)
T 3rgz_A           31 PDWSSNKNPCTFDGV-----TCR-DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSH---------INGSVSG   95 (768)
T ss_dssp             TTCCTTSCGGGSTTE-----EEE-TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSC---------EEECCCC
T ss_pred             cCCCCCCCCcCCcce-----EEC-CCcEEEEECCCCCcCCccCccChhHhccCcccccCCcCCC---------cCCCchh
Confidence            445444555555431     122 56788888877654421  023566677777777653321         1234456


Q ss_pred             cCCCCcccEEEccCcccc-ccCc--ccCCCCccceeeccCCccc-ccchhh-hccccccEEecCCccchhhchhh---hh
Q 038705          116 LFKLQRLRVLSLRGYSIF-HVPS--SIGDLKHLQYLDLSETKIK-TLPESV-NKLWNLHTLLLENCHRLKKLCAN---MG  187 (861)
Q Consensus       116 ~~~l~~L~~L~L~~~~i~-~lp~--~~~~L~~L~~L~Ls~~~i~-~lp~~i-~~L~~L~~L~l~~n~~~~~lp~~---~~  187 (861)
                      |.++++|++|+|++|.++ .+|.  .++++++|++|+|++|.+. .+|..+ +++++|++||+++|.+.+..|..   ++
T Consensus        96 ~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~  175 (768)
T 3rgz_A           96 FKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSD  175 (768)
T ss_dssp             CCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTT
T ss_pred             hccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhc
Confidence            888888888888888876 4566  7888888888888888876 555554 78888888888888776766666   67


Q ss_pred             hccccceeecCCCcccccCccccccccccccccceEecccCCCCcccccccccccceeeecCccCCCChhHHHHHhhhcc
Q 038705          188 SLIKLHHLKNSNVKALEEMPKGIGNLTHLLTLSRFVVGKDVGSGLRTLKLLKHLQGTLDISKLENVKDASEAKEAQLIEK  267 (861)
Q Consensus       188 ~L~~L~~L~l~~~~~~~~~p~~i~~l~~L~~L~~~~~~~~~~~~~~~l~~l~~L~~~l~~~~l~~~~~~~~~~~~~l~~~  267 (861)
                      ++++|++|++++|.+.+..|  ++++++|++|++..+.....  +..                             +..+
T Consensus       176 ~l~~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n~l~~~--~~~-----------------------------l~~l  222 (768)
T 3rgz_A          176 GCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTG--IPF-----------------------------LGDC  222 (768)
T ss_dssp             CCTTCCEEECCSSEEESCCB--CTTCTTCCEEECCSSCCCSC--CCB-----------------------------CTTC
T ss_pred             cCCCCCEEECCCCcccccCC--cccCCcCCEEECcCCcCCCC--Ccc-----------------------------cccC
Confidence            88888888888888555444  37777888776654432211  111                             3344


Q ss_pred             cCcchhheeeccCCCCCCcchhhHHHhhcccCCCCCccEEEEeecCCC-CCCcCCCCCCcCCeeEEEEeCCCCCCCCC-C
Q 038705          268 RNLLRLLLEWTSSTSDDPMEHENVTLMLDGLKPHRNLEELTIRGYGGT-TFPTWMGDSSFANLVLLRFEGCHRCTSLP-S  345 (861)
Q Consensus       268 ~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~-~~p~~~~~~~~~~L~~L~L~~~~~~~~~~-~  345 (861)
                      ++|++|++++|...+.          ....+..+++|++|++++|... .+|.+    .+++|++|++++|.+.+.+| .
T Consensus       223 ~~L~~L~Ls~n~l~~~----------~~~~l~~l~~L~~L~Ls~n~l~~~~~~~----~l~~L~~L~L~~n~l~~~ip~~  288 (768)
T 3rgz_A          223 SALQHLDISGNKLSGD----------FSRAISTCTELKLLNISSNQFVGPIPPL----PLKSLQYLSLAENKFTGEIPDF  288 (768)
T ss_dssp             CSCCEEECCSSCCCSC----------HHHHTTTCSSCCEEECCSSCCEESCCCC----CCTTCCEEECCSSEEEESCCCC
T ss_pred             CCCCEEECcCCcCCCc----------ccHHHhcCCCCCEEECCCCcccCccCcc----ccCCCCEEECcCCccCCccCHH
Confidence            5555555555443221          1223455566666666666543 22322    36677777777777665555 3


Q ss_pred             CCC-CCCcceeeeccccceeEECccccCCcCcCCCCCcceEeccccccccccccCC-CCCcccccCccceEeccCCCCCc
Q 038705          346 VGQ-LPLLKHLFIIEMTSVKMVGSEFYGNHCSVPFPSLETLCFQDIQEWEGWIPHG-SGKEVNVFPQLRELSLIGCPKLQ  423 (861)
Q Consensus       346 l~~-l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~-~~~~~~~~~~L~~L~l~~c~~l~  423 (861)
                      +.. +++|++|++++|.....++..+..      +++|++|++++ +.+.+..+.. +..    +++|++|++++ +.++
T Consensus       289 ~~~~~~~L~~L~Ls~n~l~~~~p~~~~~------l~~L~~L~L~~-n~l~~~ip~~~l~~----l~~L~~L~Ls~-n~l~  356 (768)
T 3rgz_A          289 LSGACDTLTGLDLSGNHFYGAVPPFFGS------CSLLESLALSS-NNFSGELPMDTLLK----MRGLKVLDLSF-NEFS  356 (768)
T ss_dssp             SCTTCTTCSEEECCSSEEEECCCGGGGG------CTTCCEEECCS-SEEEEECCHHHHTT----CTTCCEEECCS-SEEE
T ss_pred             HHhhcCcCCEEECcCCcCCCccchHHhc------CCCccEEECCC-CcccCcCCHHHHhc----CCCCCEEeCcC-CccC
Confidence            444 377777777766554444444332      66777777776 3444333222 333    67777777777 3565


Q ss_pred             CCCCCCCC----CcceEEEeccCCCcccCCCCCccceEEEccCCCCcccccccccccccccchhhhhhhhhccCCC-CCC
Q 038705          424 GRLPECLS----SLERLVVRGCEQLTVLVSSLPKLCKLEIGGCKGMAWRSTNDVNRCCPQLLWLIAEEEQDQQQPV-FPC  498 (861)
Q Consensus       424 ~~~p~~l~----~L~~L~l~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~p~  498 (861)
                      +.+|..+.    +|+.|+++++.........                                          +.. ..+
T Consensus       357 ~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~------------------------------------------~~~~~~~  394 (768)
T 3rgz_A          357 GELPESLTNLSASLLTLDLSSNNFSGPILPN------------------------------------------LCQNPKN  394 (768)
T ss_dssp             ECCCTTHHHHTTTCSEEECCSSEEEEECCTT------------------------------------------TTCSTTC
T ss_pred             ccccHHHHhhhcCCcEEEccCCCcCCCcChh------------------------------------------hhhcccC
Confidence            56665432    3444444433211000000                                          000 003


Q ss_pred             cccEEEeecccccccchhhhhccccccEEEEecccccccccccccccCCCCccEEEecCCCCccccCCCC-CCCCCccEE
Q 038705          499 SLQYLELSQCRYLVKLPQALLSLGFLREMEIYGNLIKEESIQSSSTRYTSLLEYLYIDDCASLTSLLPKN-ELPATLEHL  577 (861)
Q Consensus       499 ~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~-~~~~~L~~L  577 (861)
                      +|++|++++|.+.+.+|..+..+++|+.|++++|  .+.......+..+++|++|++++|. +...++.. ..++     
T Consensus       395 ~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N--~l~~~~p~~l~~l~~L~~L~L~~n~-l~~~~p~~~~~l~-----  466 (768)
T 3rgz_A          395 TLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN--YLSGTIPSSLGSLSKLRDLKLWLNM-LEGEIPQELMYVK-----  466 (768)
T ss_dssp             CCCEEECCSSEEEEECCGGGGGCTTCCEEECCSS--EEESCCCGGGGGCTTCCEEECCSSC-CCSCCCGGGGGCT-----
T ss_pred             CccEEECCCCccccccCHHHhcCCCCCEEECcCC--cccCcccHHHhcCCCCCEEECCCCc-ccCcCCHHHcCCC-----
Confidence            5666666666666666666666666666666666  2222222223455566666666653 22211111 1122     


Q ss_pred             EEecCCCcccccccCCCcccCcEEeeccccCcchhhhhccCCCCccEEeeccccCcccccccccCCCCCcEEeeccCCCc
Q 038705          578 HVKSCGNLAFLSLVGNLPKALKYLSVDHCLKLKSLAERLDNNSSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNL  657 (861)
Q Consensus       578 ~l~~~~~l~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~  657 (861)
                                         +|++|++++|...+.+|..+..+++|++|++++|.+.+.+|..+..+++|++|++++|...
T Consensus       467 -------------------~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~  527 (768)
T 3rgz_A          467 -------------------TLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFS  527 (768)
T ss_dssp             -------------------TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCE
T ss_pred             -------------------CceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCccc
Confidence                               3444444444333333444444444444444444444444444444444444444444333


Q ss_pred             eecCCCCCCcCCccEEEeccccCcccccccCCCCCccCEE----------------------------------------
Q 038705          658 ISFPDGGFLSSTLTKLWIYECEKLKALPNGMHNLTSLQEL----------------------------------------  697 (861)
Q Consensus       658 ~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L----------------------------------------  697 (861)
                      +.+|..+..+++|+.|++++|++.+.+|..+.....+..+                                        
T Consensus       528 ~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  607 (768)
T 3rgz_A          528 GNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRL  607 (768)
T ss_dssp             EECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGG
T ss_pred             CcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhcc
Confidence            3444433344444444444444444443333222222111                                        


Q ss_pred             ------eecCCCCCcccCCC-CCCCCccEEEecCccCcccccccccCCcCCCcCeEEeecCCCccccCCCcccCcCCCCc
Q 038705          698 ------EIGDLPSMVYFPED-GFPTNLHSLEIRDMKMWKSLIEWEPLNRFTSLRRLSIHGCQDMVSFPQDNIGMMLPASL  770 (861)
Q Consensus       698 ------~l~~n~~l~~~~~~-~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L  770 (861)
                            ++..+..-..+|.. ..+++|+.||+++|++.+.+|..  ++.+++|+.|++++|...+.+|....   -+++|
T Consensus       608 ~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~--l~~l~~L~~L~Ls~N~l~g~ip~~l~---~L~~L  682 (768)
T 3rgz_A          608 STRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKE--IGSMPYLFILNLGHNDISGSIPDEVG---DLRGL  682 (768)
T ss_dssp             GGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGG--GGGCTTCCEEECCSSCCCSCCCGGGG---GCTTC
T ss_pred             ccccccccccceecccCchhhhccccccEEECcCCcccccCCHH--HhccccCCEEeCcCCccCCCCChHHh---CCCCC
Confidence                  11111111111111 22455666666666666555554  56666666666666655555555432   22455


Q ss_pred             cEEEeccCCCCcccccCCCCCCCCCEEeccCCCCcccCCCCCCccccceeeccCCcchHH----HHhccCCccccccccC
Q 038705          771 TKLEIVRFSNLEYLSSVGESLPSLECLILDDCPKLRYFPDKGLPPSLLQLHISNCPLIEE----SCRKDGGQYWHLISDI  846 (861)
Q Consensus       771 ~~L~l~~~~~l~~l~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~sL~~L~l~~c~~l~~----~~~~~~~~~~~~~~~~  846 (861)
                      +.|+++++.--..++.....+++|+.|++++|+--+.+|..+.+.++....+.+||.++-    .|....+.+|++++|+
T Consensus       683 ~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~  762 (768)
T 3rgz_A          683 NILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRS  762 (768)
T ss_dssp             CEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC----------
T ss_pred             CEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCc
Confidence            555555543333344334778889999999997777888877777787788888876542    5999999999999999


Q ss_pred             ceEE
Q 038705          847 PCVY  850 (861)
Q Consensus       847 ~~v~  850 (861)
                      +.++
T Consensus       763 ~~~~  766 (768)
T 3rgz_A          763 HHHH  766 (768)
T ss_dssp             ----
T ss_pred             cccC
Confidence            9775

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		861
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	3e-06
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	8e-04
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	1e-04
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	6e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	8e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	8e-04
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	0.004

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 47.7 bits (112), Expect = 3e-06
 Identities = 42/247 (17%), Positives = 86/247 (34%), Gaps = 8/247 (3%)

Query: 581 SCGNLAFLSLVGNLPKALKYLSVDHCLKLKSLAERLDNNSSLEAVKISYCENLIVLPDGL 640
            C +L    +  +LP     L + +    +       N  +L  + +   +   + P   
Sbjct: 16  QCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAF 75

Query: 641 LKLNHLQEIFISHCPNLISFPDGGFLSSTLTKLWIYECEKLKALPNGMHNLTSLQELEIG 700
             L  L+ +++S    L   P+   +  TL +L ++E E  K   +  + L  +  +E+G
Sbjct: 76  APLVKLERLYLSKN-QLKELPEK--MPKTLQELRVHENEITKVRKSVFNGLNQMIVVELG 132

Query: 701 DLPSMVYFPEDGFPTNLHSLEIRDMKMWKSLIEWEPLNRFTSLRRLSIHGCQDMVSFPQD 760
             P      E+G    +  L    +      I   P     SL  L + G +        
Sbjct: 133 TNPLKSSGIENGAFQGMKKLSYIRIADTN--ITTIPQGLPPSLTELHLDGNKITKVDAAS 190

Query: 761 NIGMMLPASLTKLEIVRFSNLEYLSSVGESLPSLECLILDDCPKLRYFPDKGLPPSLLQL 820
             G+    +L KL +   S     +    + P L  L L++   ++          +  +
Sbjct: 191 LKGLN---NLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVV 247

Query: 821 HISNCPL 827
           ++ N  +
Sbjct: 248 YLHNNNI 254

PyMOL of d1xkua_

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		861
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.85
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.81
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.81
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.79
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.79
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.78
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.73
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.66
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.66
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.65
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.61
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.61
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.46
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.46
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.44
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.44
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.42
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.41
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.39
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.38
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.35
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.34
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.33
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.33
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.3
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.29
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.27
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.25
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.24
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.18
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.1
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.92
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.85
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.8
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.75
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.55
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.1
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.0
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.13
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.59
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.35
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.65

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.85  E-value=5.3e-20  Score=197.59  Aligned_cols=80  Identities=18%  Similarity=0.298  Sum_probs=65.5

Q ss_pred             CCCcccEEEccCccccccCcccCCCCccceeeccCCcccccchhhhccccccEEecCCccchhhchhhhhhccccceeec
Q 038705          118 KLQRLRVLSLRGYSIFHVPSSIGDLKHLQYLDLSETKIKTLPESVNKLWNLHTLLLENCHRLKKLCANMGSLIKLHHLKN  197 (861)
Q Consensus       118 ~l~~L~~L~L~~~~i~~lp~~~~~L~~L~~L~Ls~~~i~~lp~~i~~L~~L~~L~l~~n~~~~~lp~~~~~L~~L~~L~l  197 (861)
                      .+.+|++|+++++.|+.+ +.+..+++|++|++++|+|+.+|. |+++++|++|++++|.+. .++ .++.+++|+.|++
T Consensus        42 ~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n~i~-~i~-~l~~l~~L~~L~~  117 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNNQIA-DIT-PLANLTNLTGLTL  117 (384)
T ss_dssp             HHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSCCC-CCG-GGTTCTTCCEEEC
T ss_pred             HhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCcc-ccCCcccccccccccccc-ccc-ccccccccccccc
Confidence            456788999999988887 468888999999999999988864 889999999999988644 343 3888889999998


Q ss_pred             CCCc
Q 038705          198 SNVK  201 (861)
Q Consensus       198 ~~~~  201 (861)
                      +++.
T Consensus       118 ~~~~  121 (384)
T d2omza2         118 FNNQ  121 (384)
T ss_dssp             CSSC
T ss_pred             cccc
Confidence            8887

PyMOL of d2omza2

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure