Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways. Arabidopsis thaliana (taxid: 3702)
Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.
Cell division-promoting factor involved in leaf blade differentiation, inflorescence branching, as well as in carpel and silique shape. Promotes the number of xylem cells. Regulates positively the gibberellin signaling pathway leading to germination, hypocotyl elongation, and leaf expansion. Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.
Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.
Regulates gene expression patterns in meristems and thus modulates organ development. Required for correct embryon patterning and cotyledon organogenesis. Modulates auxin signaling pathway in early embryos. Involved in the cytokinin signaling pathway that promotes shoot regeneration. Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.
Required for correct embryo patterning and cotyledon organogenesis. May regulates positively the gibberellin signaling pathway leading to germination, hypocotyl elongation, and leaf expansion. Involved in the cytokinin signaling pathway that promotes shoot regeneration, probably through transcriptional activation of target genes such as CUC1. Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.
Score = 69.3 bits (168), Expect = 7e-12, Method: Compositional matrix adjust.
Identities = 34/55 (61%), Positives = 39/55 (70%)
Query: 6 ELLYGNPKRSSRQSSRYLGVRRRPWGRYAAEIRNPRTKERHWLGTFDAAEEAAIA 60
+L GN K + + Y GVR+RPWGRYAAEIR+P K R WLGTFD AEEAA A
Sbjct: 11 DLKGGNVKTNGVKEVHYRGVRKRPWGRYAAEIRDPGKKSRVWLGTFDTAEEAAKA 65
Transcription factor that binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways. Probably acts as a transcriptional repressor and may regulate other AtERFs.
Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.
Score = 68.2 bits (165), Expect = 2e-11, Method: Compositional matrix adjust.
Identities = 34/55 (61%), Positives = 37/55 (67%)
Query: 6 ELLYGNPKRSSRQSSRYLGVRRRPWGRYAAEIRNPRTKERHWLGTFDAAEEAAIA 60
L GN K + Y GVR+RPWGRYAAEIR+P K R WLGTFD AEEAA A
Sbjct: 11 NLKGGNVKTDGVKEVHYRGVRKRPWGRYAAEIRDPGKKSRVWLGTFDTAEEAAKA 65
Acts as a transcriptional repressor. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways mediated by ethylene, that seems to depend on a protein kinase/phosphatase cascade, and to be influenced by methyl-jasmonate. May regulate other AtERFs.
Score = 67.4 bits (163), Expect = 2e-11, Method: Compositional matrix adjust.
Identities = 33/56 (58%), Positives = 39/56 (69%)
Query: 5 PELLYGNPKRSSRQSSRYLGVRRRPWGRYAAEIRNPRTKERHWLGTFDAAEEAAIA 60
P+ N ++ + RY GVR+RPWGRYAAEIR+P K R WLGTFD AEEAA A
Sbjct: 8 PDPATTNQTHNNAKEIRYRGVRKRPWGRYAAEIRDPGKKTRVWLGTFDTAEEAARA 63
Acts as a transcriptional repressor. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways, and could also regulate other AtERFs.
Arabidopsis thaliana (taxid: 3702)
Close Homologs in the Non-Redundant Database Detected by BLAST
>gnl|CDD|237985 cd00018, AP2, DNA-binding domain found in transcription regulators in plants such as APETALA2 and EREBP (ethylene responsive element binding protein)
In EREBPs the domain specifically binds to the 11bp GCC box of the ethylene response element (ERE), a promotor element essential for ethylene responsiveness. EREBPs and the C-repeat binding factor CBF1, which is involved in stress response, contain a single copy of the AP2 domain. APETALA2-like proteins, which play a role in plant development contain two copies. Length = 61
In EREBPs the domain specifically binds to the 11bp GCC box of the ethylene response element (ERE), a promotor element essential for ethylene responsiveness. EREBPs and the C-repeat binding factor CBF1, which is involved in stress response, contain a single copy of the AP2 domain. APETALA2-like proteins, which play a role in plant development contain two copies.
>PF00847 AP2: AP2 domain; InterPro: IPR001471 Pathogenesis-related genes transcriptional activator binds to the GCC-box pathogenesis-related promoter element and activates the plant's defence genes
Ethylene, chemically the simplest plant hormone, participates in a number of stress responses and developmental processes: e.g., fruit ripening, inhibition of stem and root elongation, promotion of seed germination and flowering, senescence of leaves and flowers, and sex determination []. DNA sequence elements that confer ethylene responsiveness have been shown to contain two 11bp GCC boxes, which are necessary and sufficient for transcriptional control by ethylene. Ethylene responsive element binding proteins (EREBPs) have now been identified in a variety of plants. The proteins share a similar domain of around 59 amino acids, which interacts directly with the GCC box in the ERE.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 3IGM_A 3GCC_A 1GCC_A 2GCC_A.
>PF05036 SPOR: Sporulation related domain; InterPro: IPR007730 This 70 residue domain is composed of two 35 residue repeats that are found in bacterial proteins involved in sporulation and cell division, such as FtsN, CwlM and RlpA
This repeat might be involved in binding peptidoglycan. FtsN is an essential cell division protein with a simple bitopic topology: a short N-terminal cytoplasmic segment fused to a large carboxy periplasmic domain through a single transmembrane domain. The repeats lie at the periplasmic C terminus, which has an RNP-like fold []. FtsN localises to the septum ring complex. The CwlM protein is a cell wall hydrolase, where the C-terminal region, including the repeats, determines substrate specificity []. RlpA is a rare lipoprotein A protein that may be important for cell division. Its N-terminal cysteine may be attached to thioglyceride and N-fatty acyl residues [].; PDB: 1X60_A 1UTA_A.
>PF08846 DUF1816: Domain of unknown function (DUF1816); InterPro: IPR014945 Q4C9H3 from SWISSPROT is associated with the IPR008213 from INTERPRO domain suggesting this protein could have a role in phycobilisomes
>PF08471 Ribonuc_red_2_N: Class II vitamin B12-dependent ribonucleotide reductase; InterPro: IPR013678 This domain is found to the N terminus of the ribonucleotide reductase barrel domain (IPR000788 from INTERPRO)
It occurs in bacterial class II ribonucleotide reductase proteins which depend upon coenzyme B12 (deoxyadenosylcobalamine) []. ; GO: 0004748 ribonucleoside-diphosphate reductase activity, 0050897 cobalt ion binding, 0055114 oxidation-reduction process
>PF14112 DUF4284: Domain of unknown function (DUF4284)
P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. They share the same fold in their catalytic domain and the overall reaction mechanism with the superfamily of DNA breaking-rejoining enzymes. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes.
>pdb|1GCC|A Chain A, Solution Nmr Structure Of The Complex Of Gcc-Box Binding Domain Of Aterf1 And Gcc-Box Dna, Minimized Average Structure Length = 63
