Citrus Sinensis ID: 038715


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MATNRYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPSRALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCDCGIIFSSQNLAASGGMAQSQAQELFSSSMPSTDSDSNTNIRMNPSISRDNIENSLRPLSMSSVGVMVSSNLDPILTSRVSKPYLSSVCGSNACAMAIGSSFTSSTALLQKAAEMGTMMRFTVFSSSSITSSGFLRQGSSNGLYVDKNLEPGDQRESCSLLQSKNGNAASALVQVHMGGSEKMTADFLWAEVEQPVGSGHSNYGKKRSLGGTVVDLGYSNE
ccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccEEEcccccccccccccccccccccccccccccccccccEEEcccccc
cccccEEEEEccccccHHHHHHHHHccccccccccccccccccEEEEEccccccccccccHcHccHHHHHHHccccccccccEccccccEEEEEccHHHHHcccccEEEEcccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccEcccccccccccccccHcccccccccHHHHHHHcccccccccEEEEEcccccccccccccccEEEccccEEEEccccc
MATNRYICEvchkgfqrdqnlqlhrkghnlpwklmqrpttqvkkgvyvcpkpncvhhhpsralgdltgvkkhfcrkhgekkwkcdkcskcyavqsDWKAHTkicgtrehrcdcgiifssqnlaasggmAQSQAQELfsssmpstdsdsntnirmnpsisrdnienslrplsmsSVGVMvssnldpiltsrvskpylssvcgsnacamaigssfTSSTALLQKAAEMGTMMRFTVfssssitssgflrqgssnglyvdknlepgdqrescsLLQSKNGNAASALVQVHMGGSEKMTADFLWaeveqpvgsghsnygkkrslggtvvdlgysne
MATNRYICEVchkgfqrdqnlqlhrkghnlpwklmqrptTQVKKGVYVCPKPNCVHhhpsralgdltgVKKHFCRKhgekkwkcdkcskCYAVQSDWKAHTKICGTREHRCDCGIIFSSQNLAASGGMAQSQAQELFSSSMPSTDSDSNTNIRMNPSISRDNIENSLRPLSMSSVGVMVSSNLDPILTSRVSKPYLSSVCGSNACAMAIGSSFTSSTALLQKAAEMGTMMRFTVFSSSSITSSGFLRQGSSNGLYVDKNLEPGDQRESCSLLQSKNGNAASALVQVHMGGSEKMTADFLWAEVEQPvgsghsnygkkrslggtvvdlgysne
MATNRYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPSRALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCDCGIIFSSQNLaasggmaqsqaqELFsssmpstdsdsntnIRMNPSISRDNIENSLRPLsmssvgvmvssNLDPILTSRVSKPYLSSVCGSNACAMAIGSSFTSSTALLQKAAEMGTMMRFTVFssssitssGFLRQGSSNGLYVDKNLEPGDQRESCSLLQSKNGNAASALVQVHMGGSEKMTADFLWAEVEQPVGSGHSNYGKKRSLGGTVVDLGYSNE
****RYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPSRALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCDCGIIFSS**************************************************************NLDPILTSRVSKPYLSSVCGSNACAMAIGSSFTSSTALLQKAAEMGTMMRFTVFS*************************************************V*******MTADFLWAEV*****************************
MATNRYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQ****QVKKGVYVCPKPNCVHHHPSRALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCDCGIIFSSQNLAASGGMAQSQAQELFSSSMPSTDSDSNTNI****************************************************************TALLQKAAEMGTMMRFTVFS**********************************************************TADFLW********************************
MATNRYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPSRALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCDCGIIFSSQNL***************************TNIRMNPSISRDNIENSLRPLSMSSVGVMVSSNLDPILTSRVSKPYLSSVCGSNACAMAIGSSFTSSTALLQKAAEMGTMMRFTVFSSSSITSSGFLRQGSSNGLYVDKNLEPGDQRESCSLLQSKNGNAASALVQVHMGGSEKMTADFLWAEVEQPVGSGHSNYGKKRSLGGTVVDLGYSNE
**TNRYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPSRALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCDCGIIFSSQNLAASGGMAQSQAQE******************************************************************************TSSTALLQKAAEMGTMMR**********SS**LRQGSSNGLYVDKNLE*****************AASALVQVHMGGSEKMTADFLWAEVEQPVGSGHSNYGKKRSLGGTVVDLGYSN*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATNRYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPSRALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCDCGIIFSSQNLAASGGMAQSQAQELFSSSMPSTDSDSNTNIRMNPSISRDNIENSLRPLSMSSVGVMVSSNLDPILTSRVSKPYLSSVCGSNACAMAIGSSFTSSTALLQKAAEMGTMMRFTVFSSSSITSSGFLRQGSSNGLYVDKNLEPGDQRESCSLLQSKNGNAASALVQVHMGGSEKMTADFLWAEVEQPVGSGHSNYGKKRSLGGTVVDLGYSNE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query332 2.2.26 [Sep-21-2011]
Q9ZWA6 506 Zinc finger protein MAGPI no no 0.364 0.239 0.776 3e-59
Q9FFH3466 Zinc finger protein NUTCR no no 0.364 0.259 0.776 2e-57
Q700D2503 Zinc finger protein JACKD no no 0.364 0.240 0.737 3e-54
Q9C8N5499 Protein SENSITIVE TO PROT no no 0.364 0.242 0.318 4e-13
Q943I6522 Zinc finger protein STOP1 no no 0.349 0.222 0.318 8e-13
Q2QX40465 Zinc finger protein STAR3 no no 0.409 0.292 0.309 1e-11
Q8VWG3303 Protein TRANSPARENT TESTA no no 0.355 0.389 0.341 1e-10
O43313 823 ATM interactor OS=Homo sa yes no 0.334 0.134 0.355 2e-09
Q6P9S1 818 ATM interactor OS=Mus mus yes no 0.219 0.089 0.386 2e-08
Q8R0T2568 Zinc finger protein 768 O no no 0.328 0.191 0.278 2e-05
>sp|Q9ZWA6|MGP_ARATH Zinc finger protein MAGPIE OS=Arabidopsis thaliana GN=MGP PE=1 SV=1 Back     alignment and function desciption
 Score =  229 bits (583), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 94/121 (77%), Positives = 111/121 (91%)

Query: 1   MATNRYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPS 60
           MATNR++CE+C KGFQRDQNLQLHR+GHNLPWKL QR + +V+K VYVCP+ +CVHHHP+
Sbjct: 65  MATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQRTSKEVRKRVYVCPEKSCVHHHPT 124

Query: 61  RALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCDCGIIFSSQ 120
           RALGDLTG+KKHFCRKHGEKKWKC+KC+K YAVQSDWKAH+K CGTRE+RCDCG IFS +
Sbjct: 125 RALGDLTGIKKHFCRKHGEKKWKCEKCAKRYAVQSDWKAHSKTCGTREYRCDCGTIFSRR 184

Query: 121 N 121
           +
Sbjct: 185 D 185




Probable transcription factor that regulates tissue boundaries and asymmetric cell division. Might be involved in the sequestration of 'SHORT-ROOT' to the nucleus.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FFH3|NUC_ARATH Zinc finger protein NUTCRACKER OS=Arabidopsis thaliana GN=NUC PE=2 SV=1 Back     alignment and function description
>sp|Q700D2|JKD_ARATH Zinc finger protein JACKDAW OS=Arabidopsis thaliana GN=JKD PE=1 SV=1 Back     alignment and function description
>sp|Q9C8N5|STOP1_ARATH Protein SENSITIVE TO PROTON RHIZOTOXICITY 1 OS=Arabidopsis thaliana GN=STOP1 PE=2 SV=1 Back     alignment and function description
>sp|Q943I6|STOP1_ORYSJ Zinc finger protein STOP1 homolog OS=Oryza sativa subsp. japonica GN=Os01g0871200 PE=2 SV=1 Back     alignment and function description
>sp|Q2QX40|ART1_ORYSJ Zinc finger protein STAR3 OS=Oryza sativa subsp. japonica GN=STAR3 PE=2 SV=1 Back     alignment and function description
>sp|Q8VWG3|TT1_ARATH Protein TRANSPARENT TESTA 1 OS=Arabidopsis thaliana GN=TT1 PE=2 SV=1 Back     alignment and function description
>sp|O43313|ATMIN_HUMAN ATM interactor OS=Homo sapiens GN=ATMIN PE=1 SV=2 Back     alignment and function description
>sp|Q6P9S1|ATMIN_MOUSE ATM interactor OS=Mus musculus GN=Atmin PE=2 SV=2 Back     alignment and function description
>sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
255543258 453 nucleic acid binding protein, putative [ 0.981 0.719 0.532 1e-102
359483213 443 PREDICTED: uncharacterized protein LOC10 0.981 0.735 0.515 4e-96
297735664394 unnamed protein product [Vitis vinifera] 0.981 0.827 0.515 1e-95
356576787 529 PREDICTED: zinc finger protein NUTCRACKE 0.888 0.557 0.446 8e-65
296089673 513 unnamed protein product [Vitis vinifera] 0.656 0.424 0.486 7e-64
49387768 492 putative zinc finger protein [Oryza sati 0.647 0.436 0.513 8e-64
125539660 492 hypothetical protein OsI_07423 [Oryza sa 0.647 0.436 0.513 1e-63
413937049 508 hypothetical protein ZEAMMB73_994420 [Ze 0.683 0.446 0.502 6e-63
356522186 498 PREDICTED: zinc finger protein NUTCRACKE 0.692 0.461 0.5 2e-62
319428678 515 zinc finger protein [Phaseolus vulgaris] 0.671 0.433 0.501 3e-62
>gi|255543258|ref|XP_002512692.1| nucleic acid binding protein, putative [Ricinus communis] gi|223548653|gb|EEF50144.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 210/394 (53%), Positives = 253/394 (64%), Gaps = 68/394 (17%)

Query: 1   MATNRYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPS 60
           MATNRYICEVCHKGFQRDQNLQLHR+GHNLPWKL QRPTTQ+KK VYVCP+P C+HH PS
Sbjct: 48  MATNRYICEVCHKGFQRDQNLQLHRRGHNLPWKLKQRPTTQIKKRVYVCPEPTCMHHDPS 107

Query: 61  RALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCDCGIIFS-- 118
           RALGDLTG+KKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTRE+RCDCG IFS  
Sbjct: 108 RALGDLTGIKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREYRCDCGTIFSRK 167

Query: 119 --------------------SQNLAASGGMAQSQAQELFSSSMPSTDSDSNTNIRMNPSI 158
                               +QNLAA+GG+ QSQ  EL +S+MPS+ S S  N  MN + 
Sbjct: 168 DSFITHRAFCDALAEENYKANQNLAATGGILQSQVPELVTSTMPSSISCSKKNSIMNLTN 227

Query: 159 SRDNIENSLRPLSMSSVGVMVSSNLDPILTSRVSKPYLSSVCGSNACAMAIGSSFTSSTA 218
             +NI+ SLRPLS++S  +++ S L P+L  R S   L+S   SN   MAIG+ +TS+TA
Sbjct: 228 PYENIDISLRPLSLNSDRLLMPSKLSPMLNPRASLACLNSPDESNVSPMAIGAPYTSATA 287

Query: 219 LLQKAAEMGT----------MMR-FTVFSSSSITSSGFLRQGSS-------------NGL 254
           LLQKAAEMGT          ++R FT +S+S + SSG   +GS              N L
Sbjct: 288 LLQKAAEMGTKISDNSISPILLRGFTGYSTSRMNSSGSAHEGSVIVSSNMGPTAASMNNL 347

Query: 255 YV-----DKNLEPGDQRESCSLLQSK------------NGNAASALVQVHMGGSEKMTAD 297
           +V     D+N  PG  R   S+ Q++              N      +V+  G +KMT D
Sbjct: 348 FVGETEFDENFNPGYPRNGYSISQTQFCESPLNMHPESRNNVNILRGEVYTEGGKKMTLD 407

Query: 298 FLWAEVEQPVGSGHSNYGKKRSLGGTVVDLGYSN 331
           FL  EVE P+   HS  GKKR   G +++LGYSN
Sbjct: 408 FL--EVE-PI--EHSTIGKKRHYEGNIMELGYSN 436




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359483213|ref|XP_002270688.2| PREDICTED: uncharacterized protein LOC100258126 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297735664|emb|CBI18351.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356576787|ref|XP_003556511.1| PREDICTED: zinc finger protein NUTCRACKER-like [Glycine max] Back     alignment and taxonomy information
>gi|296089673|emb|CBI39492.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|49387768|dbj|BAD26326.1| putative zinc finger protein [Oryza sativa Japonica Group] gi|125582301|gb|EAZ23232.1| hypothetical protein OsJ_06922 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125539660|gb|EAY86055.1| hypothetical protein OsI_07423 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|413937049|gb|AFW71600.1| hypothetical protein ZEAMMB73_994420 [Zea mays] Back     alignment and taxonomy information
>gi|356522186|ref|XP_003529728.1| PREDICTED: zinc finger protein NUTCRACKER-like [Glycine max] Back     alignment and taxonomy information
>gi|319428678|gb|ADV56701.1| zinc finger protein [Phaseolus vulgaris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
TAIR|locus:2173624 500 IDD1 "AT5G66730" [Arabidopsis 0.364 0.242 0.776 1.1e-60
TAIR|locus:2101739452 IDD2 "AT3G50700" [Arabidopsis 0.364 0.267 0.768 1.1e-60
TAIR|locus:2024193 506 MGP "AT1G03840" [Arabidopsis t 0.364 0.239 0.776 1.4e-60
TAIR|locus:2051688 516 IDD4 "indeterminate(ID)-domain 0.364 0.234 0.760 4.8e-60
TAIR|locus:2132397402 IDD12 "AT4G02670" [Arabidopsis 0.364 0.300 0.786 1.1e-58
TAIR|locus:2051698 602 IDD5 "AT2G02070" [Arabidopsis 0.364 0.200 0.768 1.1e-58
TAIR|locus:2167608466 NUC "AT5G44160" [Arabidopsis t 0.364 0.259 0.776 1.1e-58
TAIR|locus:2205672455 IDD7 "AT1G55110" [Arabidopsis 0.364 0.265 0.770 2.9e-58
TAIR|locus:2078262446 AT3G45260 "AT3G45260" [Arabido 0.364 0.271 0.762 4.2e-57
TAIR|locus:2204503467 AT1G14580 "AT1G14580" [Arabido 0.364 0.259 0.743 8.8e-57
TAIR|locus:2173624 IDD1 "AT5G66730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 574 (207.1 bits), Expect = 1.1e-60, Sum P(2) = 1.1e-60
 Identities = 94/121 (77%), Positives = 110/121 (90%)

Query:     1 MATNRYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPS 60
             MATNR++CE+C+KGFQRDQNLQLHR+GHNLPWKL QR T +V+K VYVCP   CVHH PS
Sbjct:    56 MATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQRSTKEVRKKVYVCPVSGCVHHDPS 115

Query:    61 RALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCDCGIIFSSQ 120
             RALGDLTG+KKHFCRKHGEKKWKC+KCSK YAVQSDWKAH+KICGT+E++CDCG +FS +
Sbjct:   116 RALGDLTGIKKHFCRKHGEKKWKCEKCSKKYAVQSDWKAHSKICGTKEYKCDCGTLFSRR 175

Query:   121 N 121
             +
Sbjct:   176 D 176


GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0009937 "regulation of gibberellic acid mediated signaling pathway" evidence=IMP
GO:0010029 "regulation of seed germination" evidence=IMP
GO:0010431 "seed maturation" evidence=IMP
TAIR|locus:2101739 IDD2 "AT3G50700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024193 MGP "AT1G03840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051688 IDD4 "indeterminate(ID)-domain 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132397 IDD12 "AT4G02670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051698 IDD5 "AT2G02070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167608 NUC "AT5G44160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205672 IDD7 "AT1G55110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078262 AT3G45260 "AT3G45260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204503 AT1G14580 "AT1G14580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00029729001
SubName- Full=Chromosome chr9 scaffold_49, whole genome shotgun sequence; (394 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 332
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.92
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.92
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.82
KOG3608467 consensus Zn finger proteins [General function pre 99.8
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.76
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.76
KOG3608467 consensus Zn finger proteins [General function pre 99.67
KOG3576267 consensus Ovo and related transcription factors [T 99.59
KOG3576267 consensus Ovo and related transcription factors [T 99.53
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.4
PLN03086567 PRLI-interacting factor K; Provisional 99.15
PLN03086567 PRLI-interacting factor K; Provisional 98.91
PHA00733128 hypothetical protein 98.89
PHA00733128 hypothetical protein 98.73
KOG3993500 consensus Transcription factor (contains Zn finger 98.53
PHA0276855 hypothetical protein; Provisional 98.44
PHA0276855 hypothetical protein; Provisional 98.4
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.29
PHA0061644 hypothetical protein 97.92
PHA0061644 hypothetical protein 97.85
KOG3993500 consensus Transcription factor (contains Zn finger 97.82
PHA0073279 hypothetical protein 97.8
PHA0073279 hypothetical protein 97.74
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.71
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.67
COG5189423 SFP1 Putative transcriptional repressor regulating 97.47
COG5189423 SFP1 Putative transcriptional repressor regulating 97.33
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.22
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.14
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.13
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.05
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.98
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.73
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.42
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.33
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.17
smart0035526 ZnF_C2H2 zinc finger. 96.17
COG5048467 FOG: Zn-finger [General function prediction only] 95.71
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 95.62
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.57
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.24
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.76
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.59
PRK04860160 hypothetical protein; Provisional 94.55
KOG1146 1406 consensus Homeobox protein [General function predi 94.49
PRK04860160 hypothetical protein; Provisional 93.93
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.88
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 93.71
smart0035526 ZnF_C2H2 zinc finger. 93.54
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 92.69
COG5236493 Uncharacterized conserved protein, contains RING Z 92.14
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 90.66
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 90.31
COG5048467 FOG: Zn-finger [General function prediction only] 90.08
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 89.7
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 88.22
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 87.13
KOG2893 341 consensus Zn finger protein [General function pred 86.27
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 85.1
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 84.92
COG404965 Uncharacterized protein containing archaeal-type C 84.86
KOG1146 1406 consensus Homeobox protein [General function predi 84.19
PF09986214 DUF2225: Uncharacterized protein conserved in bact 81.02
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 80.81
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 80.05
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.92  E-value=1.5e-26  Score=198.78  Aligned_cols=132  Identities=20%  Similarity=0.370  Sum_probs=105.1

Q ss_pred             CCcceecCCCCCCCCCCCCccCChhhHhhhhccccC---CCccccccChhhhcCchhhHHHHHHhCCCCeeee-cCCccc
Q 038715           43 KKGVYVCPKPNCVHHHPSRALGDLTGVKKHFCRKHG---EKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCD-CGIIFS  118 (332)
Q Consensus        43 ~~~~~~C~~C~C~~~~~~~~f~~~~~L~~H~~~h~~---ek~~~C~~C~~~f~~~~~L~~H~~~h~~k~~~C~-C~k~f~  118 (332)
                      ....|+|+.|       ++.+.+.++|.+|+++|..   .+.+.|.+|++.|.+...|+.|+++|. -+.+|. |||.|+
T Consensus       127 ~~~r~~c~eC-------gk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~-l~c~C~iCGKaFS  198 (279)
T KOG2462|consen  127 KHPRYKCPEC-------GKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT-LPCECGICGKAFS  198 (279)
T ss_pred             cCCceecccc-------ccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC-CCccccccccccc
Confidence            4456778887       8888888888888877753   456888888888888888888888853 678887 888888


Q ss_pred             cchhHhhcCCccchhhhhccCCCCccCCCCcccccCCCCcccccccCCCCceecccccccccCcccccccccC---CCCc
Q 038715          119 SQNLAASGGMAQSQAQELFSSSMPSTDSDSNTNIRMNPSISRDNIENSLRPLSMSSVGVMVSSNLDPILTSRV---SKPY  195 (332)
Q Consensus       119 ~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~f~~~~~~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~~~---~~p~  195 (332)
                      +..+|+.                                  |.|+|+|||||.|+.|+|+|..+++|+.||++   .|+|
T Consensus       199 RPWLLQG----------------------------------HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~  244 (279)
T KOG2462|consen  199 RPWLLQG----------------------------------HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKH  244 (279)
T ss_pred             chHHhhc----------------------------------ccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccc
Confidence            8888873                                  88888888888888888888888888888888   7788


Q ss_pred             cCCCCCCCcccccccccccChhHHHHHHHH
Q 038715          196 LSSVCGSNACAMAIGSSFTSSTALLQKAAE  225 (332)
Q Consensus       196 ~C~~C~~~~~~~~~~~~f~~~~~L~~H~~~  225 (332)
                      +|..|+         ++|...+-|.+|...
T Consensus       245 qC~~C~---------KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  245 QCPRCG---------KSFALKSYLNKHSES  265 (279)
T ss_pred             cCcchh---------hHHHHHHHHHHhhhh
Confidence            888888         888888888888653



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-04
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
 Score = 40.3 bits (95), Expect = 6e-05
 Identities = 23/100 (23%), Positives = 36/100 (36%), Gaps = 22/100 (22%)

Query: 6   YICEV--CHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPSRAL 63
           Y+C    C K F++   L++H+  H           TQ     Y CP   C      +  
Sbjct: 2   YVCHFENCGKAFKKHNQLKVHQFSH-----------TQQLP--YECPHEGC-----DKRF 43

Query: 64  GDLTGVKKHFCRKH-GEKKWKCDKCSKCYAVQSDWKAHTK 102
              + +K+H  + H G    K D CS      + +  H  
Sbjct: 44  SLPSRLKRHE-KVHAGYPCKKDDSCSFVGKTWTLYLKHVA 82


>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.94
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.91
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.88
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.87
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.85
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.84
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.83
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.83
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.83
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.82
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.82
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.81
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.8
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.78
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.72
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.7
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.69
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.69
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.68
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.67
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.66
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.65
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.65
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.64
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.6
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.6
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.6
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.59
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.59
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.58
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.58
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.58
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.55
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.54
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.52
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.51
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.48
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.47
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.46
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.46
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.43
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.43
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.42
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.42
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.41
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.41
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.36
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.34
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.34
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.34
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.33
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.3
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.3
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.29
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.29
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.29
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.28
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.28
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.28
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.26
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.26
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.25
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.24
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.22
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.22
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.22
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.22
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.18
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.18
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.17
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.15
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.14
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.13
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.11
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.07
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.03
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.03
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.02
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.01
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.01
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.0
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.0
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.98
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.96
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.91
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.88
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.87
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.87
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.87
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.86
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.86
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.85
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.85
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.85
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.85
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.85
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.85
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.85
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.84
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.84
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.84
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.84
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.84
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.84
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.83
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.83
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.83
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.83
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.83
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.83
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.83
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.83
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.82
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.82
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.81
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.81
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.81
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.81
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.81
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.81
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.81
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.8
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.8
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.79
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.79
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.77
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.77
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.77
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.76
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.76
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.76
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.76
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.75
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.75
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.74
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.74
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.74
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.74
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.73
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.71
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.71
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.71
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.67
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.67
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.67
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.67
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.66
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.66
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.66
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.66
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.65
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.65
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.65
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.65
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.65
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.65
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.65
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.65
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.65
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.64
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.63
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.63
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.63
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.63
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.63
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.62
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.62
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.62
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.61
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.61
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.61
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.6
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.6
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.6
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.6
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.59
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.59
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.59
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.58
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.57
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.57
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.57
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.56
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.55
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.55
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.53
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.53
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.53
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.52
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.51
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.5
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.49
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.48
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.44
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.43
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.43
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.38
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.32
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.26
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.26
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.23
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.21
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.21
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.1
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.1
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.09
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.07
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.06
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.06
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.03
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.02
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.02
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.01
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.01
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.0
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.99
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.99
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.98
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.97
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.96
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.95
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.95
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.94
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.93
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.87
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.84
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.04
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.83
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.83
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.82
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.82
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.81
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.79
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.78
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.78
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.78
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.77
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.77
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.75
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.74
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.74
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.92
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.73
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.91
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.71
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.88
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.69
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.69
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.68
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.68
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.58
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.57
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.53
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.51
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.5
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.48
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.46
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.46
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.43
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.39
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.37
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.37
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.32
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.43
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.31
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.3
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.39
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.27
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.24
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.74
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.7
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.42
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.29
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.17
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.16
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.28
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.72
2e72_A49 POGO transposable element with ZNF domain; zinc fi 91.8
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 90.72
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 87.47
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 86.61
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 85.77
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 84.74
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.97  E-value=6.6e-33  Score=235.84  Aligned_cols=152  Identities=20%  Similarity=0.372  Sum_probs=92.0

Q ss_pred             CCccCChhhHhhhhccccCCCccccccChhhhcCchhhHHHHHH-hCCCCeeee-cCCccccchhHhhcCCccchhhhhc
Q 038715           60 SRALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKI-CGTREHRCD-CGIIFSSQNLAASGGMAQSQAQELF  137 (332)
Q Consensus        60 ~~~f~~~~~L~~H~~~h~~ek~~~C~~C~~~f~~~~~L~~H~~~-h~~k~~~C~-C~k~f~~~~~l~~h~~~~~~~~~~~  137 (332)
                      ++.|.....|..|++.|.++++|.|+.|++.|.+...|..|++. +++++|.|+ |++.|.+...|.       .|+++|
T Consensus        28 ~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~-------~H~~~h  100 (190)
T 2i13_A           28 GKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLR-------AHQRTH  100 (190)
T ss_dssp             ---CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHH-------HHHHHH
T ss_pred             ccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHH-------HHHHhc
Confidence            44444444444444444444444444444444444444444444 344444444 444444444444       234444


Q ss_pred             cCCCCccCCCCcccccCCC-CcccccccCCCCceecccccccccCcccccccccC---CCCccCCCCCCCcccccccccc
Q 038715          138 SSSMPSTDSDSNTNIRMNP-SISRDNIENSLRPLSMSSVGVMVSSNLDPILTSRV---SKPYLSSVCGSNACAMAIGSSF  213 (332)
Q Consensus       138 ~~~~~~~c~~c~~~f~~~~-~~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~~~---~~p~~C~~C~~~~~~~~~~~~f  213 (332)
                      .++++|.|+.|++.|.... +..|+++|++++||.|++|++.|.+...|..|+++   ++||+|++|+         +.|
T Consensus       101 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~---------~~f  171 (190)
T 2i13_A          101 TGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECG---------KSF  171 (190)
T ss_dssp             HTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTC---------CEE
T ss_pred             CCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCC---------Ccc
Confidence            4444444444444444222 23588888889999999999999999999999888   8899999999         999


Q ss_pred             cChhHHHHHHHHhc
Q 038715          214 TSSTALLQKAAEMG  227 (332)
Q Consensus       214 ~~~~~L~~H~~~~~  227 (332)
                      .+...|..|++.+.
T Consensus       172 ~~~~~L~~H~~~H~  185 (190)
T 2i13_A          172 SRRDALNVHQRTHT  185 (190)
T ss_dssp             SSHHHHHHHHTTC-
T ss_pred             CCHHHHHHHHHhcC
Confidence            99999999987653



>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 332
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 32.3 bits (74), Expect = 0.004
 Identities = 10/35 (28%), Positives = 13/35 (37%), Gaps = 1/35 (2%)

Query: 75  RKH-GEKKWKCDKCSKCYAVQSDWKAHTKICGTRE 108
           R H GEK ++C  C   +      K H     T  
Sbjct: 1   RTHSGEKPYECYICHARFTQSGTMKMHILQKHTEN 35


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.46
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.41
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.97
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.89
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.88
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.88
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.86
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.85
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.83
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.83
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.81
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.8
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.77
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.77
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.71
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.67
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.67
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.61
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.61
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.55
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.49
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.48
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.41
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.41
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.38
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.32
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.27
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.27
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.27
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.23
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.17
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.14
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.13
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.11
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.1
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.1
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.01
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.94
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.88
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.73
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.71
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.56
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.5
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.46
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.44
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.31
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.11
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.07
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.06
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.01
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.0
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.95
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.9
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.88
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.82
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.79
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.79
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.78
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.76
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.74
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.73
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.61
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.57
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.54
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.51
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.51
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.48
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.47
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.14
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.11
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.1
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.09
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.96
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.94
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 95.92
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.91
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.79
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.76
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.7
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.61
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.51
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.39
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.32
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.28
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.95
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.84
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.74
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.61
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.58
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.51
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.08
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 93.13
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.88
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 92.85
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.97
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.46
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 91.09
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 90.32
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 89.64
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 84.11
d1y0jb136 U-shaped transcription factor, different fingers { 83.33
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 83.11
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 81.75
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 81.7
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 80.93
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 80.65
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.46  E-value=1.8e-14  Score=93.98  Aligned_cols=53  Identities=19%  Similarity=0.269  Sum_probs=41.3

Q ss_pred             CCceecccccccccChhHHHHHHHhcCCCcccccCccccCCCcceecCCCCCCCCCCCCccCChhhHhhhhccc
Q 038715            3 TNRYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPSRALGDLTGVKKHFCRK   76 (332)
Q Consensus         3 ~k~~~C~~C~k~f~~~~~L~~H~~~h~~~~~l~~~~~~~~~~~~~~C~~C~C~~~~~~~~f~~~~~L~~H~~~h   76 (332)
                      ||||+|+ ||+.|.....|..|+++|+             +++||.|++|       ++.|...+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht-------------~ekpy~C~~C-------~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHL-------------GLRPYGCGVC-------GKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHS-------------CCCSEECTTT-------SCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccc-------------cccCCcCCCc-------CCEecCHHHHHHHHhcC
Confidence            5778884 8888888888888887777             7777888887       78888888888887765



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure