Citrus Sinensis ID: 038715

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MATNRYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPSRALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCDCGIIFSSQNLAASGGMAQSQAQELFSSSMPSTDSDSNTNIRMNPSISRDNIENSLRPLSMSSVGVMVSSNLDPILTSRVSKPYLSSVCGSNACAMAIGSSFTSSTALLQKAAEMGTMMRFTVFSSSSITSSGFLRQGSSNGLYVDKNLEPGDQRESCSLLQSKNGNAASALVQVHMGGSEKMTADFLWAEVEQPVGSGHSNYGKKRSLGGTVVDLGYSNE
ccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccEEEcccccccccccccccccccccccccccccccccccEEEcccccc
MATNRYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPSRALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCDCGIIFSSQNLAASGGMAQSQAQE**************TNI*************************************************************TSSTALLQKAAEMGTMMRFTVFS*************************************************V*******MTADFLWAEV*****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATNRYICEVCHKGFQRDQNLQLHRKGHNLPWKLMQRPTTQVKKGVYVCPKPNCVHHHPSRALGDLTGVKKHFCRKHGEKKWKCDKCSKCYAVQSDWKAHTKICGTREHRCDCGIIFSSQNLAASGGMAQSQAQELFSSSMPSTDSDSNTNIRMNPSISRDNIENSLRPLSMSSVGVMVSSNLDPILTSRVSKPYLSSVCGSNACAMAIGSSFTSSTALLQKAAEMGTMMRFTVFSSSSITSSGFLRQGSSNGLYVDKNLEPGDQRESCSLLQSKNGNAASALVQVHMGGSEKMTADFLWAEVEQPVGSGHSNYGKKRSLGGTVVDLGYSNE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GLI, chain A
Confidence level:very confident
Coverage over the Query: 3-29,43-124
View the alignment between query and template
View the model in PyMOL
Template: 2I13, chain A
Confidence level:confident
Coverage over the Query: 15-28,45-191
View the alignment between query and template
View the model in PyMOL
Template: 1TF6, chain A
Confidence level:confident
Coverage over the Query: 3-29,43-125,160-227
View the alignment between query and template
View the model in PyMOL