Citrus Sinensis ID: 038787


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MTPPLCAKGCGFYGTKEHKSMCSKCYNDFLEEQVTDGVVKRPLKLMQPNPSILVFDPRSLQSPSCSSSERTTIDSAAVECSSGKTTSALEKRCEICDKKVGSIELKCRCGHLYCGTHRYPKEHACTFDFKKFDRETLVEDDPLIRADKLEGRI
cccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccEEECcccccccccccccccccccccHHHHHHHHHHHcccEEcccccccc
**PPLCAKGCGFYGTKEHKSMCSKCYNDFLEEQ*********LKLMQPNP***************************************EKRCEICDKKVGSIELKCRCGHLYCGTHRYPKEHACTFDFKKFDRETLVEDDPLIRADKLEG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPPLCAKGCGFYGTKEHKSMCSKCYNDFLEEQVTDGVVKRPLKLMQPNPSILVFDPRSLQSPSCSSSERTTIDSAAVECSSGKTTSALEKRCEICDKKVGSIELKCRCGHLYCGTHRYPKEHACTFDFKKFDRETLVEDDPLIRADKLEGRI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger A20 and AN1 domain-containing stress-associated protein 6 May be involved in environmental stress response.probableQ852K5
Zinc finger A20 and AN1 domain-containing stress-associated protein 9 May be involved in environmental stress response.probableO49663

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WFF, chain A
Confidence level:very confident
Coverage over the Query: 87-147
View the alignment between query and template
View the model in PyMOL
Template: 2KZY, chain A
Confidence level:very confident
Coverage over the Query: 2-38
View the alignment between query and template
View the model in PyMOL