Citrus Sinensis ID: 038885

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400------

MWVTAIALLLAFVSADNTPKIERISGSAGDVLEDDPVGKLKVYVYELPSKYNKKLLLKDPRCLTHMFAAEIFMHRFLLSSPVRTLNPEEADWFYTPIYPTCDLTPTGLPLPFKSPRMMRSAIQLISSNWPYWNRTEGADHFFVVPHDFGACFHYQEEKAIERGILPLLQRATLVQTFGQRNHVCLNEGSITIPPYAPPQKMQAHQIPPDTPRSIFVYFRGLFYDVNNDPEGGYYARGARAAVWENFKNNPLFDISTDHPTTYYEDMQRAIFCLCPLGWAPWSPRLVEAVVFGCIPVIIADDIVLPFADAIPWEEIGMFVAEEDVPKLDTILTSIPPEVILRKQRLLANPSMKRAMLFPQPAQPGDAFHQILNGLARKLPHDKSTYLKPGGKFLNWTSGPVGDLKPW

cHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEccccccccccccccccccccccHHHHHHHHHHcccccccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHcccccccccccccEEEccccccccccHHHHHHHHHccHHHcccccEEcccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccHHHHHHHHHHccccccEECcccccccHHHHHHcccEEECcccccccccHHHHHHHcccEEEEEEcccccccccccccccEEEEEccccHHcHHHHHHcccHHHHHHHHHHHcccccEEEEECccccccccHHHHHHHHHHHHcccccccEEccccEEcccccccccccccc

MWVTAIALLLAFVSAD****************EDDPVGKLKVYVYELPSKYNKKLLLKDPRCLTHMFAAEIFMHRFLLSSPVRTLNPEEADWFYTPIYPTCDLTPTGLPLPFKSPRMMRSAIQLISSNWPYWNRTEGADHFFVVPHDFGACFHYQEEKAIERGILPLLQRATLVQTFGQRNHVCLNEGSITIPPYAPPQKMQAHQIPPDTPRSIFVYFRGLFYDVNNDPEGGYYARGARAAVWENFKNNPLFDISTDHPTTYYEDMQRAIFCLCPLGWAPWSPRLVEAVVFGCIPVIIADDIVLPFADAIPWEEIGMFVAEEDVPKLDTILTSIPPEVILRKQRLLANPSMKRAMLFPQPAQPGDAFHQILNGLARKLPHDKSTYLKPGGKFLNWTSGPVGDLKPW

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable beta-1,4-xylosyltransferase IRX10	Involved in the synthesis of the hemicellulose glucuronoxylan, a major component of secondary cell walls. Probably involved in the elongation of glucuronoxylan xylosyl backbone.	confident	Q9FZJ1
Probable glucuronosyltransferase Os01g0926700	Involved in the synthesis of glucuronoxylan hemicellulose in secondary cell walls.	confident	Q8S1X7
Probable beta-1,4-xylosyltransferase IRX10L	Involved in the synthesis of the hemicellulose glucuronoxylan, a major component of secondary cell walls. Probably involved in the elongation of glucuronoxylan xylosyl backbone.	probable	Q940Q8

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OKP, chain A
Confidence level:probable
Coverage over the Query: 260-380
View the alignment between query and template
View the model in PyMOL

Template: 2NZW, chain A
Confidence level:probable
Coverage over the Query: 237-343
View the alignment between query and template
View the model in PyMOL