Citrus Sinensis ID: 038895

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
KLTADAALDPAGLVAVAVAHALALFVGVAIAANISGGHLNPAVTLGLAVGGNITILTGIFYWIAQCLGSIVACLLLQFVTSGLSIPTHAVGAGLNAAEGLVMEIVITFALVYTVYATAADPKKGPLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDFSQIWIYWVGPLIGGGLAGLVYGDIFIGSYTPASTEDYA
ccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHEEEcccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccEEHHHHHHHHHHHHHHHHHHHHccccccccccccc
********DPAGLVAVAVAHALALFVGVAIAANISGGHLNPAVTLGLAVGGNITILTGIFYWIAQCLGSIVACLLLQFVTSGLSIPTHAVGAGLNAAEGLVMEIVITFALVYTVYATAADPKKGPLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDFSQIWIYWVGPLIGGGLAGLVYGDIFIGSYT********
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KLTADAALDPAGLVAVAVAHALALFVGVAIAANISGGHLNPAVTLGLAVGGNITILTGIFYWIAQCLGSIVACLLLQFVTSGLSIPTHAVGAGLNAAEGLVMEIVITFALVYTVYATAADPKKGPLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDFSQIWIYWVGPLIGGGLAGLVYGDIFIGSYTPASTEDYA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aquaporin TIP2-3 Transports methylammonium or ammonium in yeast cells, preferentially at high medium pH. May participate in vacuolar compartmentation and detoxification of ammonium.confidentQ9FGL2
Probable aquaporin TIP-type Channel protein in tonoplast. These proteins may allow the diffusion of amino acids and/or peptides from the vacuolar compartment to the cytoplasm.probableP33560
Probable aquaporin TIP-type RB7-5A Channel protein in tonoplast. These proteins may allow the diffusion of amino acids and/or peptides from the vacuolar compartment to the cytoplasm.probableP21653

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J4N, chain A
Confidence level:very confident
Coverage over the Query: 7-197
View the alignment between query and template
View the model in PyMOL