Citrus Sinensis ID: 038925

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
ELERVIGKDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYSHGLKVIQSSLANLLHRFTWKLPGNMSNNLSMEEVFKLANRKNFHLKLWLS
ccccccccccEEEEEEEEEccccccccccccccccccccccccccccccEEEccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEcccccEEEEEc
ccccEcccccEEEEEEEEEcccccccccHHHcccHHHcccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEccccEEEEcc
ELERVIGKDAQVLVNTwsierdpalwenrndfcpkiflgksinvkgndfeflpfgagrrmcpgyshGLKVIQSSLANLLHRFtwklpgnmsnnlSMEEVFKLANRKNFHLKLWLS
elervigkdaqvlvntwsierdpalwenrNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYSHGLKVIQSSLANLLHRFTWKLPGNMSNNLSMEEVFKLAnrknfhlklwls
ELERVIGKDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYSHGLKVIQSSLANLLHRFTWKLPGNMSNNLSMEEVFKLANRKNFHLKLWLS
*****IGKDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYSHGLKVIQSSLANLLHRFTWKLPGNMSNNLSMEEVFKLANRKNFHLKLW**
ELERVIGKDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYSHGLKVIQSSLANLLHRFTWKLPGNMSNNLSMEEVFKLANRKNFHLKLWLS
ELERVIGKDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYSHGLKVIQSSLANLLHRFTWKLPGNMSNNLSMEEVFKLANRKNFHLKLWLS
*LERVIGKDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYSHGLKVIQSSLANLLHRFTWKLPGNMSNNLSMEEVFKLANRKNFHLKLWLS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ELERVIGKDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYSHGLKVIQSSLANLLHRFTWKLPGNMSNNLSMEEVFKLANRKNFHLKLWLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query115 2.2.26 [Sep-21-2011]
O64636512 Cytochrome P450 76C1 OS=A no no 0.860 0.193 0.52 3e-26
O64635511 Cytochrome P450 76C4 OS=A no no 0.860 0.193 0.51 8e-26
O64637512 Cytochrome P450 76C2 OS=A no no 0.895 0.201 0.5 1e-24
O64638515 Cytochrome P450 76C3 OS=A no no 0.886 0.198 0.485 5e-23
O81971496 Cytochrome P450 71D9 OS=G no no 0.913 0.211 0.453 9e-23
P24465502 Cytochrome P450 71A1 OS=P N/A no 0.930 0.213 0.435 1e-22
O81974504 Cytochrome P450 71D8 OS=G no no 0.878 0.200 0.490 2e-22
P37117507 Cytochrome P450 71A4 OS=S N/A no 0.878 0.199 0.470 5e-22
P58049496 Cytochrome P450 71B11 OS= no no 0.930 0.215 0.435 5e-22
P37121467 Cytochrome P450 76A1 (Fra N/A no 0.930 0.229 0.453 6e-22
>sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 Back     alignment and function desciption
 Score =  116 bits (291), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/100 (52%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 8   KDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYSHG 67
           KD QVLVN W+I RDP++W+N + F P+ FLGK ++V+G D+E  PFGAGRR+CPG    
Sbjct: 397 KDTQVLVNVWAIGRDPSVWDNPSQFEPERFLGKDMDVRGRDYELTPFGAGRRICPGMPLA 456

Query: 68  LKVIQSSLANLLHRFTWKLP-GNMSNNLSMEEVFKLANRK 106
           +K +   LA+LL+ F WKLP G +S +L M+E F L   K
Sbjct: 457 MKTVSLMLASLLYSFDWKLPKGVLSEDLDMDETFGLTLHK 496

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 Back     alignment and function description
>sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 Back     alignment and function description
>sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 Back     alignment and function description
>sp|O81971|C71D9_SOYBN Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=2 SV=1 Back     alignment and function description
>sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 Back     alignment and function description
>sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 Back     alignment and function description
>sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 Back     alignment and function description
>sp|P58049|C71BB_ARATH Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 Back     alignment and function description
>sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
225442104 511 PREDICTED: flavonoid 3'-monooxygenase-li 0.913 0.205 0.650 4e-34
147826996 500 hypothetical protein VITISV_021888 [Viti 0.913 0.21 0.650 4e-34
74273619 497 cytochrome P450 DDWF1 [Gossypium hirsutu 0.921 0.213 0.626 1e-33
255560607 511 flavonoid 3-hydroxylase, putative [Ricin 0.913 0.205 0.622 1e-33
449523091 508 PREDICTED: LOW QUALITY PROTEIN: flavonoi 0.930 0.210 0.629 4e-33
285028880 511 flavonoid 3' hydroxylase [Actinidia chin 0.913 0.205 0.622 5e-33
308190440 513 cytochrome P450 mono-oxygenase [Artemisi 0.913 0.204 0.584 3e-32
449453365 503 PREDICTED: flavonoid 3'-monooxygenase-li 0.930 0.212 0.620 6e-32
255569720 225 flavonoid 3-hydroxylase, putative [Ricin 0.913 0.466 0.622 7e-32
255549934 521 flavonoid 3-hydroxylase, putative [Ricin 0.913 0.201 0.622 1e-31
>gi|225442104|ref|XP_002273390.1| PREDICTED: flavonoid 3'-monooxygenase-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 69/106 (65%), Positives = 82/106 (77%), Gaps = 1/106 (0%)

Query: 6   IGKDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYS 65
           I KD +VLVN W+I RDP +W+  N+F P+ F+GK+I+VKG DFE LPFG GRRMCPGYS
Sbjct: 391 IPKDTRVLVNVWTIGRDPEIWDQPNEFIPERFIGKNIDVKGQDFELLPFGTGRRMCPGYS 450

Query: 66  HGLKVIQSSLANLLHRFTWKLPGNMS-NNLSMEEVFKLANRKNFHL 110
            GLKVIQSSLANLLH F WKLPG+M   +LSMEE+F L+  K   L
Sbjct: 451 LGLKVIQSSLANLLHGFKWKLPGDMKPGDLSMEEIFGLSTPKKIPL 496

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147826996|emb|CAN77776.1| hypothetical protein VITISV_021888 [Vitis vinifera] Back     alignment and taxonomy information
>gi|74273619|gb|ABA01477.1| cytochrome P450 DDWF1 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|255560607|ref|XP_002521317.1| flavonoid 3-hydroxylase, putative [Ricinus communis] gi|223539395|gb|EEF40985.1| flavonoid 3-hydroxylase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449523091|ref|XP_004168558.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|285028880|gb|ADC34701.1| flavonoid 3' hydroxylase [Actinidia chinensis] Back     alignment and taxonomy information
>gi|308190440|gb|ADO16185.1| cytochrome P450 mono-oxygenase [Artemisia annua] Back     alignment and taxonomy information
>gi|449453365|ref|XP_004144428.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255569720|ref|XP_002525824.1| flavonoid 3-hydroxylase, putative [Ricinus communis] gi|223534829|gb|EEF36518.1| flavonoid 3-hydroxylase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255549934|ref|XP_002516018.1| flavonoid 3-hydroxylase, putative [Ricinus communis] gi|223544923|gb|EEF46438.1| flavonoid 3-hydroxylase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
TAIR|locus:2012693511 CYP76C6 ""cytochrome P450, fam 0.860 0.193 0.55 1e-24
TAIR|locus:2043694511 CYP76C4 ""cytochrome P450, fam 0.895 0.201 0.504 2.9e-24
TAIR|locus:2043699512 CYP76C1 ""cytochrome P450, fam 0.860 0.193 0.52 3.7e-24
TAIR|locus:2012673368 CYP76C5 ""cytochrome P450, fam 0.878 0.274 0.519 8.7e-24
TAIR|locus:2043605512 CYP76C2 ""cytochrome P450, fam 0.886 0.199 0.495 2.9e-23
TAIR|locus:2043614515 CYP76C3 ""cytochrome P450, fam 0.886 0.198 0.485 3.6e-21
TAIR|locus:2100982498 CYP76C7 ""cytochrome P450, fam 0.852 0.196 0.484 6.8e-21
TAIR|locus:2093501502 CYP71B17 ""cytochrome P450, fa 0.886 0.203 0.446 1.9e-20
TAIR|locus:2179270496 CYP71B11 ""ytochrome p450, fam 0.930 0.215 0.435 5.1e-20
TAIR|locus:2146980496 CYP71B14 ""cytochrome P450, fa 0.930 0.215 0.425 5.1e-20
TAIR|locus:2012693 CYP76C6 ""cytochrome P450, family 76, subfamily C, polypeptide 6"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 287 (106.1 bits), Expect = 1.0e-24, P = 1.0e-24
 Identities = 55/100 (55%), Positives = 68/100 (68%)

Query:     8 KDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYSHG 67
             KD+QVLVN W+I RDP +WEN   F P+ FLGK I+VKG D+E  PFGAGRR+CPG    
Sbjct:   397 KDSQVLVNVWAIGRDPLVWENPTHFEPERFLGKEIDVKGTDYELTPFGAGRRICPGLPLA 456

Query:    68 LKVIQSSLANLLHRFTWKLPGNM-SNNLSMEEVFKLANRK 106
             +K +   LA+LL+ F WKLP  + S +L MEE F L   K
Sbjct:   457 MKTVHLMLASLLYTFEWKLPNGVGSEDLDMEETFGLTVHK 496
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IDA
TAIR|locus:2043694 CYP76C4 ""cytochrome P450, family 76, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043699 CYP76C1 ""cytochrome P450, family 76, subfamily C, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012673 CYP76C5 ""cytochrome P450, family 76, subfamily C, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043605 CYP76C2 ""cytochrome P450, family 76, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043614 CYP76C3 ""cytochrome P450, family 76, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100982 CYP76C7 ""cytochrome P450, family 76, subfamily C, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093501 CYP71B17 ""cytochrome P450, family 71, subfamily B, polypeptide 17"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179270 CYP71B11 ""ytochrome p450, family 71, subfamily B, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146980 CYP71B14 ""cytochrome P450, family 71, subfamily B, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 6e-29
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 3e-28
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 5e-26
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 7e-24
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 1e-23
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 1e-17
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 7e-17
pfam00067461 pfam00067, p450, Cytochrome P450 9e-17
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 3e-12
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 1e-11
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 2e-11
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 4e-10
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-09
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 1e-08
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 5e-07
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 5e-06
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 1e-04
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 3e-04
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 3e-04
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 4e-04
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information 
 Score =  108 bits (271), Expect = 6e-29
 Identities = 47/104 (45%), Positives = 68/104 (65%), Gaps = 5/104 (4%)

Query: 6   IGKDAQVLVNTWSIERDPALWENRNDFCPKIFLGK---SINVKGNDFEFLPFGAGRRMCP 62
           I K+ ++ VN W+I RDP +WEN  +F P+ FL +    I+ +GNDFE +PFGAGRR+C 
Sbjct: 384 IPKNTRLSVNIWAIGRDPDVWENPEEFRPERFLSEKNAKIDPRGNDFELIPFGAGRRICA 443

Query: 63  GYSHGLKVIQSSLANLLHRFTWKLPGNMSNNLSMEEVFKLANRK 106
           G   G+ +++  L  L+H F WKLP  +   L+M+E F LA +K
Sbjct: 444 GTRMGIVLVEYILGTLVHSFDWKLPDGV--ELNMDEAFGLALQK 485

Length = 504
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 115
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.97
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.97
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.96
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.96
PLN02183516 ferulate 5-hydroxylase 99.96
PLN03234499 cytochrome P450 83B1; Provisional 99.96
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.96
PLN02966502 cytochrome P450 83A1 99.96
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.96
PLN02394503 trans-cinnamate 4-monooxygenase 99.96
PLN02500490 cytochrome P450 90B1 99.96
PLN02971543 tryptophan N-hydroxylase 99.96
PTZ00404482 cytochrome P450; Provisional 99.96
PLN00168519 Cytochrome P450; Provisional 99.96
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.96
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.96
PLN02738633 carotene beta-ring hydroxylase 99.96
PLN02687517 flavonoid 3'-monooxygenase 99.96
PLN02774463 brassinosteroid-6-oxidase 99.95
PLN02290516 cytokinin trans-hydroxylase 99.95
PLN02936489 epsilon-ring hydroxylase 99.95
PLN03018534 homomethionine N-hydroxylase 99.95
PLN03112514 cytochrome P450 family protein; Provisional 99.95
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.95
PLN02196463 abscisic acid 8'-hydroxylase 99.95
PLN02655466 ent-kaurene oxidase 99.95
PLN02302490 ent-kaurenoic acid oxidase 99.95
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.95
PLN02987472 Cytochrome P450, family 90, subfamily A 99.94
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.92
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.91
PLN02648480 allene oxide synthase 99.9
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.97  E-value=3e-31  Score=194.15  Aligned_cols=87  Identities=29%  Similarity=0.547  Sum_probs=80.9

Q ss_pred             ceEeCCCCEEEEchhhhccCccCCCCCCCCCCCCCCCCCCCCCCCCccceeeccccccCccchHHHHHHHHHHHHHHhhc
Q 038925            3 ERVIGKDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYSHGLKVIQSSLANLLHRF   82 (115)
Q Consensus         3 g~~ip~gt~v~~~~~~~~~~~~~~~~p~~f~P~R~~~~~~~~~~~~~~~~~Fg~G~r~C~G~~~a~~~~~~~l~~ll~~f   82 (115)
                      ++.||||+.|.++.+++||||++|+||++|+||||.+.+.. ...+..|+|||.|||+|+|++||++|+|++|+.||++|
T Consensus       386 ~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~~-~~~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~~lL~~f  464 (499)
T KOG0158|consen  386 GFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEENNK-SRHPGAYLPFGVGPRNCIGMRFALMEAKLALAHLLRNF  464 (499)
T ss_pred             CeEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCccc-ccCCccccCCCCCccccHHHHHHHHHHHHHHHHHHhhC
Confidence            78999999999999999999999999999999999976644 44667999999999999999999999999999999999


Q ss_pred             eEecCCCC
Q 038925           83 TWKLPGNM   90 (115)
Q Consensus        83 ~~~~~~~~   90 (115)
                      +++..+.+
T Consensus       465 ~~~~~~~t  472 (499)
T KOG0158|consen  465 SFEVCPTT  472 (499)
T ss_pred             EEecCCcc
Confidence            99998853

>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
1izo_A417 Cytochrome P450 Bs Beta Complexed With Fatty Acid L 2e-06
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 3e-06
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 4e-06
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 4e-06
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 4e-06
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 5e-06
3pm0_A507 Structural Characterization Of The Complex Between 7e-05
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 9e-05
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 9e-05
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 1e-04
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 1e-04
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 1e-04
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 2e-04
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-04
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-04
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-04
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 4e-04
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 4e-04
>pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 Back     alignment and structure 
Iteration: 1

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 45/84 (53%), Gaps = 8/84 (9%)
Query: 8   KDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGR----RMCPG 63
           K   VL++ +    DP LW++ ++F P+ F  +  N+    F+ +P G G       CPG
Sbjct: 310 KGTSVLLDLYGTNHDPRLWDHPDEFRPERFAEREENL----FDMIPQGGGHAEKGHRCPG 365
Query: 64  YSHGLKVIQSSLANLLHRFTWKLP 87
               ++V+++SL  L+H+  + +P
Sbjct: 366 EGITIEVMKASLDFLVHQIEYDVP 389
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-28
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 5e-28
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-25
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-25
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-19
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 3e-19
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 6e-19
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-18
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-18
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-16
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 7e-16
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-15
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 3e-15
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 6e-15
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 8e-15
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 1e-14
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-14
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 3e-14
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 3e-14
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 1e-13
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 3e-13
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 7e-13
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 3e-12
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-10
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 4e-09
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-08
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 1e-08
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 2e-08
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 4e-08
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  105 bits (264), Expect = 3e-28
 Identities = 19/103 (18%), Positives = 38/103 (36%), Gaps = 10/103 (9%)

Query: 8   KDAQVLVNTW-SIERDPALWENRNDFCPKIFLGKSINVKGN--------DFEFLPFGAGR 58
           +  ++ V  + S + DP + +    F    FL      K +         +  +P+G   
Sbjct: 350 RGDRLCVFPFISPQMDPQIHQQPEMFQFDRFLNADRTEKKDFFKNGARVKYPSVPWGTED 409

Query: 59  RMCPGYSHGLKVIQSSLANLLHRFTWKLPGNMSN-NLSMEEVF 100
            +CPG    +  I+  +  +L RF  +L    +   L     +
Sbjct: 410 NLCPGRHFAVHAIKELVFTILTRFDVELCDKNATVPLVDPSRY 452
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.97
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.97
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.97
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.97
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 99.97
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.97
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.97
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.97
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.96
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.96
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.96
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.96
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.96
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.96
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.96
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.96
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.96
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.96
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.96
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.96
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.95
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.95
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.95
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.95
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.95
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.95
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.95
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.95
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.94
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.94
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.94
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.94
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.94
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.94
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.94
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.94
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.94
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.94
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.94
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.94
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.94
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.94
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.94
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.94
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.94
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.94
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.94
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.94
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.94
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.94
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.94
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.94
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.94
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.94
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.94
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.94
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.93
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.93
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.93
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.93
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.93
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.93
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.93
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.93
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.93
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.93
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.93
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.93
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.93
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.92
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.92
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.92
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.92
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.92
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.91
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.9
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=5.9e-33  Score=200.31  Aligned_cols=111  Identities=27%  Similarity=0.396  Sum_probs=92.1

Q ss_pred             CceEeCCCCEEEEchhhhccCccCCCCCCCCCCCCCCCCCCCCCCCCccceeeccccccCccchHHHHHHHHHHHHHHhh
Q 038925            2 LERVIGKDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYSHGLKVIQSSLANLLHR   81 (115)
Q Consensus         2 ~g~~ip~gt~v~~~~~~~~~~~~~~~~p~~f~P~R~~~~~~~~~~~~~~~~~Fg~G~r~C~G~~~a~~~~~~~l~~ll~~   81 (115)
                      .||.|||||.|.++.+++||||++|+||++|+||||++.+... ..+..|+|||+|+|.|+|++||++|+++++|.|+++
T Consensus       363 ~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~-~~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~ll~~  441 (479)
T 3tbg_A          363 QGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHF-VKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQH  441 (479)
T ss_dssp             TTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCB-CCCTTCCTTCCSTTSCTTHHHHHHHHHHHHHHHHHH
T ss_pred             CCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCccc-CCCCceecCCCCCcCChhHHHHHHHHHHHHHHHHHc
Confidence            4899999999999999999999999999999999999765443 345689999999999999999999999999999999


Q ss_pred             ceEecCCCCCCCCCcceeeeee-eeCCeeEEEEe
Q 038925           82 FTWKLPGNMSNNLSMEEVFKLA-NRKNFHLKLWL  114 (115)
Q Consensus        82 f~~~~~~~~~~~~~~~~~~~~~-~~~~~~v~~~~  114 (115)
                      |++++++++. ........+++ .+.++.+++++
T Consensus       442 f~~~~~~~~~-~~~~~~~~~~~~~P~~~~v~~~p  474 (479)
T 3tbg_A          442 FSFSVPTGQP-RPSHHGVFAFLVSPSPYELCAVP  474 (479)
T ss_dssp             EEEECCTTSC-CCCSCEEESSSEEECCCCBEEEE
T ss_pred             cEEEeCCCCC-CccccccceeeecCCCeEEEEEE
Confidence            9999987742 22333333333 36677777765
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 115
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 3e-18
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 1e-17
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 4e-17
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 3e-15
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 5e-15
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-14
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 3e-12
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 5e-11
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 1e-10
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 1e-09
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 1e-09
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 8e-09
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-08
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 2e-08
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 2e-08
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 5e-08
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 7e-08
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 1e-07
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 1e-07
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 1e-06
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 6e-06
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 76.7 bits (187), Expect = 3e-18
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 1/107 (0%)

Query: 6   IGKDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYS 65
           I K   V++ ++++ RDP  W     F P+ F  K+ +   + + + PFG+G R C G  
Sbjct: 361 IPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKD-NIDPYIYTPFGSGPRNCIGMR 419

Query: 66  HGLKVIQSSLANLLHRFTWKLPGNMSNNLSMEEVFKLANRKNFHLKL 112
             L  ++ +L  +L  F++K        L +     L   K   LK+
Sbjct: 420 FALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKV 466
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.97
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.97
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.97
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.97
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.97
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.96
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.96
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.96
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.95
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.95
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.95
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.95
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.94
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.94
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.94
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.94
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.94
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.94
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.93
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.92
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.92
d1aisa289 TATA-box binding protein (TBP), C-terminal domain 90.05
d1mp9a2101 TATA-box binding protein (TBP), C-terminal domain 87.8
d1qnaa199 TATA-box binding protein (TBP), C-terminal domain 83.11
d1qnaa283 TATA-box binding protein (TBP), C-terminal domain 82.55
d1mp9a192 TATA-box binding protein (TBP), C-terminal domain 81.81
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=1.9e-32  Score=193.31  Aligned_cols=110  Identities=22%  Similarity=0.344  Sum_probs=92.3

Q ss_pred             CceEeCCCCEEEEchhhhccCccCCCCCCCCCCCCCCCCCCCCCCCCccceeeccccccCccchHHHHHHHHHHHHHHhh
Q 038925            2 LERVIGKDAQVLVNTWSIERDPALWENRNDFCPKIFLGKSINVKGNDFEFLPFGAGRRMCPGYSHGLKVIQSSLANLLHR   81 (115)
Q Consensus         2 ~g~~ip~gt~v~~~~~~~~~~~~~~~~p~~f~P~R~~~~~~~~~~~~~~~~~Fg~G~r~C~G~~~a~~~~~~~l~~ll~~   81 (115)
                      .||.||||+.|.++.+++|+||++|+||++|+||||++.+... ..+..++|||+|+|.|+|++||++|+++++|.|+++
T Consensus       351 ~g~~ipkG~~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~-~~~~~~~~FG~G~r~C~G~~~A~~~~~~~la~ll~~  429 (463)
T d3czha1         351 RGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLDSSGYF-AKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQR  429 (463)
T ss_dssp             TTEEECTTCEEEEEHHHHHTCTTTCSSTTSCCGGGGBCTTSCB-CCCTTCCTTCCSTTCCTTHHHHHHHHHHHHHHHHHH
T ss_pred             CCcEECCCCcccCcHHHhhCCcccCCChhhcCccccCCCcccc-CCCCceeCCCCCCcCCchHHHHHHHHHHHHHHHHHh
Confidence            5899999999999999999999999999999999999865442 345689999999999999999999999999999999


Q ss_pred             ceEecCCCCCCCCCcceeeeeee-eCCeeEEEEe
Q 038925           82 FTWKLPGNMSNNLSMEEVFKLAN-RKNFHLKLWL  114 (115)
Q Consensus        82 f~~~~~~~~~~~~~~~~~~~~~~-~~~~~v~~~~  114 (115)
                      |+++++++.  .++.....+++. +.+..++++.
T Consensus       430 f~~~~~~~~--~~~~~~~~~~~~~p~~~~v~~~~  461 (463)
T d3czha1         430 FHLHFPHEL--VPDLKPRLGMTLQPQPYLICAER  461 (463)
T ss_dssp             EEEECGGGC--CCCCCCCSSSSCCCCCCCBEEEE
T ss_pred             cEEEeCCCC--CCCceeccCeEEeccCcEEEEEe
Confidence            999998763  334444555544 5666676654
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1aisa2 d.129.1.1 (A:93-181) TATA-box binding protein (TBP), C-terminal domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1mp9a2 d.129.1.1 (A:97-197) TATA-box binding protein (TBP), C-terminal domain {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1qnaa1 d.129.1.1 (A:17-115) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qnaa2 d.129.1.1 (A:116-198) TATA-box binding protein (TBP), C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mp9a1 d.129.1.1 (A:5-96) TATA-box binding protein (TBP), C-terminal domain {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure