Citrus Sinensis ID: 039009


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MADEHKHEEPAGESVMEKITEKIHGHDSSSSSSSSDTDDDKKSSTSSLKTKVFRLFGREKPVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFTLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPRSLKDKKKA
ccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccECcHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHcccc
***************************************************VFRLFGREKPVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFTLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLS************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADEHKHEEPAGESVMEKITEKIHGHDSSSSSSSSDTDDDKKSSTSSLKTKVFRLFGREKPVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTLVCHCLIVALAVLFLWSNASTFINKSPPRIPEVYIPEEPVLQLASALRFEINRAFTLLREIASGRDLKKFLSVIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPRSLKDKKKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Reticulon-like protein B2 Plays a role in the Agrobacterium-mediated plant transformation via its interaction with VirB2, the major component of the T-pilus.probableQ9SUT9
Reticulon-like protein B3 probableQ9SH59

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KO2, chain A
Confidence level:probable
Coverage over the Query: 121-163
View the alignment between query and template
View the model in PyMOL