Citrus Sinensis ID: 039014


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPDESAIKTDEIKVDKETLDMLAALGMSDISGLVEVEPQSMITPPVFGRGGGRRY
ccccccHHHHHHHHHHHHHHccccccccccccEEEEEEccccccccEEccccccHHHHHHHHccccccEEEEccHHHHHHHcccccccccccccccEEcHHHHHHHHHcccccccccEEEccccccccccccccccccc
**RVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKG*V********************DESAIKTDEIKVDKETLDMLAALGMSDISGLVEV*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPDESAIKTDEIKVDKETLDMLAALGMSDISGLVEVEPQSMITPPVFGRGGGRRY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S17-3 confidentQ9SQZ1
40S ribosomal protein S17 probableQ967G1
40S ribosomal protein S17 probableP08636

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZ6, chain Q
Confidence level:very confident
Coverage over the Query: 1-125
View the alignment between query and template
View the model in PyMOL