Citrus Sinensis ID: 039045
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 295 | ||||||
| 224135619 | 294 | predicted protein [Populus trichocarpa] | 0.989 | 0.993 | 0.894 | 1e-148 | |
| 225444969 | 306 | PREDICTED: serine acetyltransferase 5-li | 0.983 | 0.947 | 0.864 | 1e-146 | |
| 147841681 | 290 | hypothetical protein VITISV_002361 [Viti | 0.983 | 1.0 | 0.861 | 1e-146 | |
| 1350550 | 294 | serine acetyltransferase [Citrullus lana | 0.996 | 1.0 | 0.854 | 1e-144 | |
| 449461463 | 294 | PREDICTED: serine acetyltransferase 5-li | 0.996 | 1.0 | 0.850 | 1e-143 | |
| 255546181 | 296 | Serine acetyltransferase, putative [Rici | 1.0 | 0.996 | 0.891 | 1e-142 | |
| 224137072 | 293 | predicted protein [Populus trichocarpa] | 0.989 | 0.996 | 0.898 | 1e-142 | |
| 388571926 | 290 | SAT [Apium graveolens] | 0.983 | 1.0 | 0.844 | 1e-141 | |
| 28460066 | 293 | serine O-acetyltransferase [Beta vulgari | 0.993 | 1.0 | 0.844 | 1e-140 | |
| 297796561 | 313 | serine O-acetyltransferase Sat-52 [Arabi | 0.996 | 0.939 | 0.816 | 1e-139 |
| >gi|224135619|ref|XP_002327263.1| predicted protein [Populus trichocarpa] gi|222835633|gb|EEE74068.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 531 bits (1368), Expect = e-148, Method: Compositional matrix adjust.
Identities = 263/294 (89%), Positives = 270/294 (91%), Gaps = 2/294 (0%)
Query: 2 PAGELRYPSPARNLTMETHAAGDDEAWVWAQIKAEARRDAESEPALASYLYSTILSHSSL 61
P GELRYPSP LT T D+ WVWAQIKAEARRDAESEPALASYLYSTILSHSSL
Sbjct: 3 PEGELRYPSPP--LTDSTTTIDDEAGWVWAQIKAEARRDAESEPALASYLYSTILSHSSL 60
Query: 62 ERSLAFHLGNKLCSSTLLSTLLYDLFLDTFSSDPALRAAAVADLRAARVRDPACVSFSHC 121
ERSL+FHLGNKLCSSTLLSTLLYDLFL+TF+SDP LR AAVADLRAAR RDPACVSFSHC
Sbjct: 61 ERSLSFHLGNKLCSSTLLSTLLYDLFLNTFTSDPGLRVAAVADLRAARARDPACVSFSHC 120
Query: 122 LLNYKGFLACQAHRVAHKLWTQSRRPLALALQSRISDVFAVDIHPAAKIGKGILFDHATG 181
LLNYKGFLACQAHRVAHKLW QSRRPLALAL SRISDVFAVDIHPAAKIGKGILFDHATG
Sbjct: 121 LLNYKGFLACQAHRVAHKLWNQSRRPLALALHSRISDVFAVDIHPAAKIGKGILFDHATG 180
Query: 182 VVIGETAVIGNNVSILHHVTLGGTGKASGDRHPKIGDGVLIGAGATILGNVKIGEGAKVG 241
VVIGETAVIGNNVSILHHVTLGGTGKASGDRHPKIGDGVLIGAGATILGNVKIGEGAK+G
Sbjct: 181 VVIGETAVIGNNVSILHHVTLGGTGKASGDRHPKIGDGVLIGAGATILGNVKIGEGAKIG 240
Query: 242 AGSVVLIDVPARATAVGNPARLVGGKEKTSSNEECPGESMDHTSFISEWSDYII 295
AGSVVLIDVP R T VGNPARLVGGKEK + EECPGESMD TSFIS+WSDYII
Sbjct: 241 AGSVVLIDVPPRTTTVGNPARLVGGKEKPAKLEECPGESMDQTSFISDWSDYII 294
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225444969|ref|XP_002282550.1| PREDICTED: serine acetyltransferase 5-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147841681|emb|CAN62211.1| hypothetical protein VITISV_002361 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|1350550|dbj|BAA12843.1| serine acetyltransferase [Citrullus lanatus] gi|1841312|dbj|BAA08479.1| serine acetyltransferase. [Citrullus lanatus var. lanatus] gi|2337772|dbj|BAA21827.1| serine acetyltransferase [Citrullus lanatus] | Back alignment and taxonomy information |
|---|
| >gi|449461463|ref|XP_004148461.1| PREDICTED: serine acetyltransferase 5-like [Cucumis sativus] gi|449529483|ref|XP_004171729.1| PREDICTED: serine acetyltransferase 5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255546181|ref|XP_002514150.1| Serine acetyltransferase, putative [Ricinus communis] gi|223546606|gb|EEF48104.1| Serine acetyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224137072|ref|XP_002322486.1| predicted protein [Populus trichocarpa] gi|222869482|gb|EEF06613.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388571926|gb|AFK08536.2| SAT [Apium graveolens] | Back alignment and taxonomy information |
|---|
| >gi|28460066|emb|CAD67560.1| serine O-acetyltransferase [Beta vulgaris] | Back alignment and taxonomy information |
|---|
| >gi|297796561|ref|XP_002866165.1| serine O-acetyltransferase Sat-52 [Arabidopsis lyrata subsp. lyrata] gi|297312000|gb|EFH42424.1| serine O-acetyltransferase Sat-52 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 295 | ||||||
| TAIR|locus:2164996 | 312 | SERAT1;1 "serine acetyltransfe | 0.996 | 0.942 | 0.716 | 1.9e-108 | |
| TAIR|locus:2012085 | 314 | SERAT2;1 "serine acetyltransfe | 0.613 | 0.576 | 0.718 | 1.7e-80 | |
| TAIR|locus:2089974 | 391 | SERAT2;2 "serine acetyltransfe | 0.613 | 0.462 | 0.723 | 7.4e-80 | |
| TAIR|locus:2127978 | 355 | SERAT3;2 "serine acetyltransfe | 0.555 | 0.461 | 0.650 | 2.3e-66 | |
| TAIR|locus:2057254 | 323 | ATSERAT3;1 [Arabidopsis thalia | 0.555 | 0.507 | 0.639 | 1.6e-63 | |
| UNIPROTKB|P0A9D4 | 273 | cysE "serine acetyltransferase | 0.579 | 0.626 | 0.598 | 2e-59 | |
| UNIPROTKB|Q9KNT2 | 273 | VC_2649 "Serine acetyltransfer | 0.501 | 0.542 | 0.621 | 8.8e-55 | |
| TIGR_CMR|VC_2649 | 273 | VC_2649 "serine acetyltransfer | 0.501 | 0.542 | 0.621 | 8.8e-55 | |
| TIGR_CMR|SPO_2247 | 270 | SPO_2247 "serine O-acetyltrans | 0.488 | 0.533 | 0.631 | 1.1e-54 | |
| POMBASE|SPAC1039.08 | 270 | SPAC1039.08 "serine acetyltran | 0.511 | 0.559 | 0.470 | 2.2e-38 |
| TAIR|locus:2164996 SERAT1;1 "serine acetyltransferase 1;1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1072 (382.4 bits), Expect = 1.9e-108, P = 1.9e-108
Identities = 222/310 (71%), Positives = 235/310 (75%)
Query: 2 PAGELRYPSPARN-LTMETH-------------AAGDDEA-WVWAQIKAEARRDAESEPA 46
PAGELR+ SP++ L+ T AA D EA +W QIKAEARRDAE+EPA
Sbjct: 3 PAGELRHQSPSKEKLSSVTQSDEAEAASAAISAAAADAEAAGLWTQIKAEARRDAEAEPA 62
Query: 47 LASYLYSTILSHSSLERSLAFHLGNKLCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 106
LASYLYSTILSHSSLERS++FHLGNKLC
Sbjct: 63 LASYLYSTILSHSSLERSISFHLGNKLCSSTLLSTLLYDLFLNTFSSDPSLRNATVADLR 122
Query: 107 XXXXXXXXCVSFSHCLLNYKGFLACQAHRVAHKLWTQSRRPLALALQSRISDVFAVDIHP 166
C+SFSHCLLNYKGFLA QAHRV+HKLWTQSR+PLALAL SRISDVFAVDIHP
Sbjct: 123 AARVRDPACISFSHCLLNYKGFLAIQAHRVSHKLWTQSRKPLALALHSRISDVFAVDIHP 182
Query: 167 AAKIGKGILFDHATGVVIGETAVIGNNVSILHHVTLGGTGKASGDRHPKIGDGVLIGAGA 226
AAKIGKGIL DHATGVV+GETAVIGNNVSILHHVTLGGTGKA GDRHPKIGDG LIGAGA
Sbjct: 183 AAKIGKGILLDHATGVVVGETAVIGNNVSILHHVTLGGTGKACGDRHPKIGDGCLIGAGA 242
Query: 227 TILGNVKIGEGAKVGAGSVVLIDVPARATAVGNPARLVGGKEK-TSSNEECPGESMDHTS 285
TILGNVKIG GAKVGAGSVVLIDVP R TAVGNPARLVGGKEK T +EECPGESMDHTS
Sbjct: 243 TILGNVKIGAGAKVGAGSVVLIDVPCRGTAVGNPARLVGGKEKPTIHDEECPGESMDHTS 302
Query: 286 FISEWSDYII 295
FISEWSDYII
Sbjct: 303 FISEWSDYII 312
|
|
| TAIR|locus:2012085 SERAT2;1 "serine acetyltransferase 2;1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089974 SERAT2;2 "serine acetyltransferase 2;2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2127978 SERAT3;2 "serine acetyltransferase 3;2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057254 ATSERAT3;1 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A9D4 cysE "serine acetyltransferase monomer" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KNT2 VC_2649 "Serine acetyltransferase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2649 VC_2649 "serine acetyltransferase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_2247 SPO_2247 "serine O-acetyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1039.08 SPAC1039.08 "serine acetyltransferase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_410108 | serine O-acetyltransferase (EC-2.3.1.30) (294 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| grail3.1757000202 | • | • | • | • | 0.942 | ||||||
| gw1.142.135.1 | • | • | • | • | 0.942 | ||||||
| fgenesh4_pg.C_LG_VIII001376 | • | • | • | • | 0.942 | ||||||
| estExt_fgenesh4_pg.C_700106 | • | • | • | • | 0.941 | ||||||
| eugene3.00130338 | • | • | • | • | 0.941 | ||||||
| eugene3.00700110 | • | • | • | • | 0.940 | ||||||
| eugene3.00700113 | • | • | • | • | 0.939 | ||||||
| eugene3.00700109 | • | • | • | • | 0.939 | ||||||
| gw1.XIV.1323.1 | • | • | • | • | 0.935 | ||||||
| grail3.0039007102 | • | • | • | 0.932 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 295 | |||
| PLN02694 | 294 | PLN02694, PLN02694, serine O-acetyltransferase | 0.0 | |
| PLN02357 | 360 | PLN02357, PLN02357, serine acetyltransferase | 1e-149 | |
| PRK11132 | 273 | PRK11132, cysE, serine acetyltransferase; Provisio | 1e-111 | |
| PLN02739 | 355 | PLN02739, PLN02739, serine acetyltransferase | 1e-104 | |
| COG1045 | 194 | COG1045, CysE, Serine acetyltransferase [Amino aci | 3e-84 | |
| TIGR01172 | 162 | TIGR01172, cysE, serine O-acetyltransferase | 8e-82 | |
| cd03354 | 101 | cd03354, LbH_SAT, Serine acetyltransferase (SAT): | 3e-55 | |
| pfam06426 | 105 | pfam06426, SATase_N, Serine acetyltransferase, N-t | 7e-53 | |
| smart00971 | 105 | smart00971, SATase_N, Serine acetyltransferase, N- | 9e-45 | |
| cd04647 | 109 | cd04647, LbH_MAT_like, Maltose O-acyltransferase ( | 5e-25 | |
| TIGR03570 | 193 | TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia | 7e-24 | |
| cd03358 | 119 | cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p | 2e-23 | |
| cd03360 | 197 | cd03360, LbH_AT_putative, Putative Acyltransferase | 2e-22 | |
| COG0110 | 190 | COG0110, WbbJ, Acetyltransferase (isoleucine patch | 3e-21 | |
| cd03357 | 169 | cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase | 4e-20 | |
| PRK10191 | 146 | PRK10191, PRK10191, putative acyl transferase; Pro | 7e-19 | |
| cd00208 | 78 | cd00208, LbetaH, Left-handed parallel beta-Helix ( | 2e-18 | |
| TIGR04016 | 146 | TIGR04016, WcaB, colanic acid biosynthesis acetylt | 5e-18 | |
| cd03349 | 145 | cd03349, LbH_XAT, Xenobiotic acyltransferase (XAT) | 4e-16 | |
| TIGR03532 | 231 | TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6 | 1e-14 | |
| cd04645 | 153 | cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra | 1e-14 | |
| COG0663 | 176 | COG0663, PaaY, Carbonic anhydrases/acetyltransfera | 8e-13 | |
| cd03351 | 254 | cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin | 2e-12 | |
| PRK05289 | 262 | PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr | 6e-12 | |
| cd05825 | 107 | cd05825, LbH_wcaF_like, wcaF-like: This group is c | 7e-12 | |
| PRK00892 | 343 | PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco | 1e-11 | |
| PRK00892 | 343 | PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco | 2e-10 | |
| COG1043 | 260 | COG1043, LpxA, Acyl-[acyl carrier protein] | 2e-10 | |
| PRK10502 | 182 | PRK10502, PRK10502, putative acyl transferase; Pro | 4e-10 | |
| TIGR01852 | 254 | TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei | 4e-10 | |
| TIGR03308 | 204 | TIGR03308, phn_thr-fam, phosphonate metabolim prot | 5e-10 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 7e-10 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 8e-10 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 2e-09 | |
| pfam00132 | 36 | pfam00132, Hexapep, Bacterial transferase hexapept | 2e-09 | |
| PRK14357 | 448 | PRK14357, glmU, bifunctional N-acetylglucosamine-1 | 2e-09 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 4e-09 | |
| PRK09527 | 203 | PRK09527, lacA, galactoside O-acetyltransferase; R | 6e-09 | |
| cd03353 | 193 | cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph | 9e-09 | |
| PRK05289 | 262 | PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr | 2e-08 | |
| cd03351 | 254 | cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin | 3e-08 | |
| COG2171 | 271 | COG2171, DapD, Tetrahydrodipicolinate N-succinyltr | 3e-08 | |
| TIGR01173 | 451 | TIGR01173, glmU, UDP-N-acetylglucosamine diphospho | 3e-08 | |
| cd03350 | 139 | cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyri | 4e-08 | |
| TIGR01853 | 324 | TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo | 7e-08 | |
| PRK09677 | 192 | PRK09677, PRK09677, putative lipopolysaccharide bi | 1e-07 | |
| COG1207 | 460 | COG1207, GlmU, N-acetylglucosamine-1-phosphate uri | 1e-07 | |
| PRK00892 | 343 | PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco | 2e-07 | |
| TIGR01853 | 324 | TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo | 2e-07 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 3e-07 | |
| PRK14354 | 458 | PRK14354, glmU, bifunctional N-acetylglucosamine-1 | 3e-07 | |
| PRK12461 | 255 | PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr | 4e-07 | |
| cd04650 | 154 | cd04650, LbH_FBP, Ferripyochelin Binding Protein ( | 6e-07 | |
| PRK10092 | 183 | PRK10092, PRK10092, maltose O-acetyltransferase; P | 8e-07 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 1e-06 | |
| cd03352 | 205 | cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl | 1e-06 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 2e-06 | |
| COG1043 | 260 | COG1043, LpxA, Acyl-[acyl carrier protein] | 4e-06 | |
| TIGR01852 | 254 | TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei | 4e-06 | |
| pfam00132 | 36 | pfam00132, Hexapep, Bacterial transferase hexapept | 4e-06 | |
| PRK14353 | 446 | PRK14353, glmU, bifunctional N-acetylglucosamine-1 | 5e-06 | |
| TIGR02353 | 695 | TIGR02353, NRPS_term_dom, non-ribosomal peptide sy | 6e-06 | |
| COG1044 | 338 | COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | 7e-06 | |
| cd03353 | 193 | cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph | 8e-06 | |
| PRK14352 | 482 | PRK14352, glmU, bifunctional N-acetylglucosamine-1 | 1e-05 | |
| PRK14356 | 456 | PRK14356, glmU, bifunctional N-acetylglucosamine-1 | 1e-05 | |
| PLN02296 | 269 | PLN02296, PLN02296, carbonate dehydratase | 2e-05 | |
| cd03356 | 79 | cd03356, LbH_G1P_AT_C_like, Left-handed parallel b | 5e-05 | |
| PRK14360 | 450 | PRK14360, glmU, bifunctional N-acetylglucosamine-1 | 7e-05 | |
| COG1208 | 358 | COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph | 9e-05 | |
| cd05787 | 79 | cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit | 1e-04 | |
| TIGR01853 | 324 | TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo | 2e-04 | |
| COG1207 | 460 | COG1207, GlmU, N-acetylglucosamine-1-phosphate uri | 3e-04 | |
| TIGR02353 | 695 | TIGR02353, NRPS_term_dom, non-ribosomal peptide sy | 3e-04 | |
| PRK11830 | 272 | PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-car | 3e-04 | |
| TIGR03991 | 337 | TIGR03991, alt_bact_glmU, UDP-N-acetylglucosamine | 3e-04 | |
| PRK14360 | 450 | PRK14360, glmU, bifunctional N-acetylglucosamine-1 | 4e-04 | |
| cd03356 | 79 | cd03356, LbH_G1P_AT_C_like, Left-handed parallel b | 5e-04 | |
| TIGR01173 | 451 | TIGR01173, glmU, UDP-N-acetylglucosamine diphospho | 7e-04 | |
| cd03356 | 79 | cd03356, LbH_G1P_AT_C_like, Left-handed parallel b | 7e-04 | |
| cd03353 | 193 | cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph | 8e-04 | |
| PRK14354 | 458 | PRK14354, glmU, bifunctional N-acetylglucosamine-1 | 0.001 | |
| PRK14356 | 456 | PRK14356, glmU, bifunctional N-acetylglucosamine-1 | 0.001 | |
| PRK14355 | 459 | PRK14355, glmU, bifunctional N-acetylglucosamine-1 | 0.001 | |
| cd04745 | 155 | cd04745, LbH_paaY_like, paaY-like: This group is c | 0.002 | |
| PRK09451 | 456 | PRK09451, glmU, bifunctional N-acetylglucosamine-1 | 0.002 | |
| COG0663 | 176 | COG0663, PaaY, Carbonic anhydrases/acetyltransfera | 0.003 | |
| PRK14358 | 481 | PRK14358, glmU, bifunctional N-acetylglucosamine-1 | 0.003 | |
| cd00208 | 78 | cd00208, LbetaH, Left-handed parallel beta-Helix ( | 0.004 |
| >gnl|CDD|178297 PLN02694, PLN02694, serine O-acetyltransferase | Back alignment and domain information |
|---|
Score = 563 bits (1451), Expect = 0.0
Identities = 266/295 (90%), Positives = 276/295 (93%), Gaps = 2/295 (0%)
Query: 1 MPAGELRYPSPARNLTMETHAAGDDEAWVWAQIKAEARRDAESEPALASYLYSTILSHSS 60
MPAGELR+PSP T A ++ AW+W QIKAEARRDAESEPALASYLYSTILSHSS
Sbjct: 2 MPAGELRHPSPP--KTNSATTADEEAAWLWTQIKAEARRDAESEPALASYLYSTILSHSS 59
Query: 61 LERSLAFHLGNKLCSSTLLSTLLYDLFLDTFSSDPALRAAAVADLRAARVRDPACVSFSH 120
LERSL+FHLGNKLCSSTLLSTLLYDLFL+TFSSDP+LRAA VADLRAARVRDPACVSFSH
Sbjct: 60 LERSLSFHLGNKLCSSTLLSTLLYDLFLNTFSSDPSLRAATVADLRAARVRDPACVSFSH 119
Query: 121 CLLNYKGFLACQAHRVAHKLWTQSRRPLALALQSRISDVFAVDIHPAAKIGKGILFDHAT 180
CLLNYKGFLACQAHRVAHKLWTQSRRPLALAL SRISDVFAVDIHPAAKIGKGILFDHAT
Sbjct: 120 CLLNYKGFLACQAHRVAHKLWTQSRRPLALALHSRISDVFAVDIHPAAKIGKGILFDHAT 179
Query: 181 GVVIGETAVIGNNVSILHHVTLGGTGKASGDRHPKIGDGVLIGAGATILGNVKIGEGAKV 240
GVVIGETAVIGNNVSILHHVTLGGTGKA GDRHPKIGDGVLIGAGATILGNVKIGEGAK+
Sbjct: 180 GVVIGETAVIGNNVSILHHVTLGGTGKACGDRHPKIGDGVLIGAGATILGNVKIGEGAKI 239
Query: 241 GAGSVVLIDVPARATAVGNPARLVGGKEKTSSNEECPGESMDHTSFISEWSDYII 295
GAGSVVLIDVP R TAVGNPARLVGGKEK + +EECPGESMDHTSFISEWSDYII
Sbjct: 240 GAGSVVLIDVPPRTTAVGNPARLVGGKEKPAKHEECPGESMDHTSFISEWSDYII 294
|
Length = 294 |
| >gnl|CDD|215205 PLN02357, PLN02357, serine acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|182987 PRK11132, cysE, serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215394 PLN02739, PLN02739, serine acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223975 COG1045, CysE, Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|200082 TIGR01172, cysE, serine O-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|219022 pfam06426, SATase_N, Serine acetyltransferase, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|198039 smart00971, SATase_N, Serine acetyltransferase, N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >gnl|CDD|223188 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|100047 cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >gnl|CDD|182295 PRK10191, PRK10191, putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >gnl|CDD|188531 TIGR04016, WcaB, colanic acid biosynthesis acetyltransferase WcaB | Back alignment and domain information |
|---|
| >gnl|CDD|100040 cd03349, LbH_XAT, Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >gnl|CDD|132571 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >gnl|CDD|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100063 cd05825, LbH_wcaF_like, wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223973 COG1043, LpxA, Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >gnl|CDD|236703 PRK10502, PRK10502, putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|132351 TIGR03308, phn_thr-fam, phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) | Back alignment and domain information |
|---|
| >gnl|CDD|237687 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|181930 PRK09527, lacA, galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|225082 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100041 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|137467 PRK09677, PRK09677, putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100055 cd04650, LbH_FBP, Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >gnl|CDD|182235 PRK10092, PRK10092, maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|223973 COG1043, LpxA, Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >gnl|CDD|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) | Back alignment and domain information |
|---|
| >gnl|CDD|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233832 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|184641 PRK14352, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237686 PRK14356, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215167 PLN02296, PLN02296, carbonate dehydratase | Back alignment and domain information |
|---|
| >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|233832 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|236996 PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234432 TIGR03991, alt_bact_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237686 PRK14356, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100058 cd04745, LbH_paaY_like, paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >gnl|CDD|181867 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237688 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| PLN02694 | 294 | serine O-acetyltransferase | 100.0 | |
| PLN02357 | 360 | serine acetyltransferase | 100.0 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 100.0 | |
| PLN02739 | 355 | serine acetyltransferase | 100.0 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 100.0 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 100.0 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 99.97 | |
| PF06426 | 105 | SATase_N: Serine acetyltransferase, N-terminal ; I | 99.88 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 99.87 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 99.86 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 99.86 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 99.86 | |
| PLN02739 | 355 | serine acetyltransferase | 99.85 | |
| PLN02694 | 294 | serine O-acetyltransferase | 99.84 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 99.8 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 99.8 | |
| PLN02357 | 360 | serine acetyltransferase | 99.79 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 99.78 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 99.77 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 99.76 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 99.74 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 99.73 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.72 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 99.71 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.7 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 99.7 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.68 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.67 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.67 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.66 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.66 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.66 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.64 | |
| PLN02296 | 269 | carbonate dehydratase | 99.63 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.63 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.63 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 99.62 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.62 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.62 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.61 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.61 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.6 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.59 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.59 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.58 | |
| PLN02472 | 246 | uncharacterized protein | 99.56 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 99.55 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.54 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.54 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.52 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.49 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 99.47 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 99.47 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.45 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.44 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 99.43 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.43 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 99.42 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.42 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.42 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.41 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.41 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.41 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.41 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.4 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.4 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.36 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 99.36 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.35 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.33 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 99.32 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 99.32 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 99.32 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.31 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.29 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.28 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.28 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.28 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 99.27 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.27 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 99.26 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.25 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 99.25 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 99.24 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.24 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.23 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.22 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.22 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.22 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.21 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.2 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.18 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.17 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.16 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.15 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.15 | |
| PLN02472 | 246 | uncharacterized protein | 99.12 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.12 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.12 | |
| PLN02296 | 269 | carbonate dehydratase | 99.12 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.11 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.09 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.09 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 99.08 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.04 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.02 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.0 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 98.99 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.99 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.97 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 98.97 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 98.96 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.93 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 98.93 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 98.92 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 98.91 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 98.91 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 98.9 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.89 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 98.88 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 98.88 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.88 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 98.88 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.87 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 98.87 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 98.87 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 98.86 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.85 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.85 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 98.81 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 98.8 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 98.8 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 98.78 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 98.77 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 98.77 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 98.77 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 98.76 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 98.75 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 98.75 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 98.73 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 98.71 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 98.7 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 98.7 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 98.68 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 98.67 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 98.58 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 98.51 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.5 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 98.49 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.44 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 98.4 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 98.38 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 98.37 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 98.35 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 98.31 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 98.28 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 98.26 | |
| PF00132 | 36 | Hexapep: Bacterial transferase hexapeptide (six re | 98.25 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.24 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 98.22 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 98.19 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 98.17 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 98.12 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.12 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 98.1 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 98.09 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.08 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.06 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 98.05 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 98.03 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 97.95 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 97.85 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 97.85 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 97.78 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 97.75 | |
| PF00132 | 36 | Hexapep: Bacterial transferase hexapeptide (six re | 97.72 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 97.71 | |
| PF06426 | 105 | SATase_N: Serine acetyltransferase, N-terminal ; I | 97.67 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 97.63 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 97.38 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 97.1 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 96.33 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 96.23 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 95.86 |
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-63 Score=451.97 Aligned_cols=293 Identities=90% Similarity=1.376 Sum_probs=270.9
Q ss_pred CCCCCCCCCCCCCCccccCccCCCChHHHHHHHHHHHHHhhhcCcchhhhHHHHhcCCCCHHHHHHHHHHHhhcccccch
Q 039045 1 MPAGELRYPSPARNLTMETHAAGDDEAWVWAQIKAEARRDAESEPALASYLYSTILSHSSLERSLAFHLGNKLCSSTLLS 80 (295)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~il~~~~~~~~l~~~la~~l~~~~~~~ 80 (295)
||.++.....|... ........+.+++|++||.||+..+++||+|++|++.+||+|++|+++|+|+||++|.+..|++
T Consensus 2 ~~~~~~~~~~~~~~--~~~~~~~~~~~~~w~~~~~ea~~~~~~ep~l~~~~~~~il~~~~~~~al~~~l~~~l~~~~~~~ 79 (294)
T PLN02694 2 MPAGELRHPSPPKT--NSATTADEEAAWLWTQIKAEARRDAESEPALASYLYSTILSHSSLERSLSFHLGNKLCSSTLLS 79 (294)
T ss_pred CCCCCCCccCCCCC--CCCccccccchHHHHHHHHHHHHHHhcCccHHHHHHHHhcCCcCHHHHHHHHHHHHhCCCcCCH
Confidence 56666555433222 2233445555679999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHhccCCHHHHHHHHHHHHHHhccCccccccchhhcccchhhHHHHHHHHHHHHhcCChhHHHHHhhccccce
Q 039045 81 TLLYDLFLDTFSSDPALRAAAVADLRAARVRDPACVSFSHCLLNYKGFLACQAHRVAHKLWTQSRRPLALALQSRISDVF 160 (295)
Q Consensus 81 ~~l~~~~~~~~~~~~~~~~~~~~dl~~~~~~dpa~~~~~~~~~~~~gf~al~~~r~a~~l~~~~~~~~~~~~~~~~~~~~ 160 (295)
.+|.++|.++|.++|++++.+..|+.+...+||+|..++.++++|+||++++.||++||||..+++.++..++.+++..+
T Consensus 80 ~~~~~~~~~~~~~~~~~~~~~~~D~~a~~~rdpa~~~~~~~~l~~~Gf~Al~~yR~ah~l~~~~~~~la~~~~~~~~~~~ 159 (294)
T PLN02694 80 TLLYDLFLNTFSSDPSLRAATVADLRAARVRDPACVSFSHCLLNYKGFLACQAHRVAHKLWTQSRRPLALALHSRISDVF 159 (294)
T ss_pred HHHHHHHHHHHHHCHHHHHHHHHHHHHHHhcCccccchhhhhhcCHhHHHHHHHHHHHHHHHCCChhHHHHHHHhcccce
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeEeCCCceecCceEEcCCcCeEECCCcEEcCCcEEccCCEECCCCCCCCCCCCEECCCCEECCCCEECCCCEECCCCEE
Q 039045 161 AVDIHPAAKIGKGILFDHATGVVIGETAVIGNNVSILHHVTLGGTGKASGDRHPKIGDGVLIGAGATILGNVKIGEGAKV 240 (295)
Q Consensus 161 ~v~Ig~~a~IG~~v~I~~~~~v~IG~~~~IG~~v~I~~gv~Igg~~~~~~~~~~~IG~~v~IGa~a~I~~~v~IG~~~~I 240 (295)
+++||+++.||++++|+|+++++||++|+||+||+|++++++|+.+...+.++++||++|+||+|++|+++++||++|+|
T Consensus 160 gvdI~p~A~IG~gv~Idh~tGVVIGe~a~IGdnv~I~~~VtLGg~g~~~~~r~piIGd~V~IGagA~Ilggi~IGd~a~I 239 (294)
T PLN02694 160 AVDIHPAAKIGKGILFDHATGVVIGETAVIGNNVSILHHVTLGGTGKACGDRHPKIGDGVLIGAGATILGNVKIGEGAKI 239 (294)
T ss_pred eEEeCCcceecCCEEEeCCCCeEECCCcEECCCCEEeecceeCCcccccCCCccEECCCeEECCeeEECCCCEECCCCEE
Confidence 99999999999999999999999999999999999999999999888777899999999999999999999999999999
Q ss_pred CCCCEEcCCCCCCcEEEccCcEEecCCCCCCCCCCCCCccccccccccccccccC
Q 039045 241 GAGSVVLIDVPARATAVGNPARLVGGKEKTSSNEECPGESMDHTSFISEWSDYII 295 (295)
Q Consensus 241 gagsvV~~~Vp~~~~v~G~PA~~i~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~ 295 (295)
|+|++|++|||++++++|+||+++++...+.....+|+..|||+++..+|+||.|
T Consensus 240 GAgSVV~kdVP~~~~v~G~PAkiv~~~~~~~~~~~~p~~~m~~~~~~~~~~~~~~ 294 (294)
T PLN02694 240 GAGSVVLIDVPPRTTAVGNPARLVGGKEKPAKHEECPGESMDHTSFISEWSDYII 294 (294)
T ss_pred CCCCEECCcCCCCcEEEccCcEEEccCCCcccccCCcchhhcccccccccccccC
Confidence 9999999999999999999999999865444445779999999999999999987
|
|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PF06426 SATase_N: Serine acetyltransferase, N-terminal ; InterPro: IPR010493 The N-terminal domain of serine acetyltransferase has a sequence that is conserved in plants [] and bacteria [] | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >PF06426 SATase_N: Serine acetyltransferase, N-terminal ; InterPro: IPR010493 The N-terminal domain of serine acetyltransferase has a sequence that is conserved in plants [] and bacteria [] | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 295 | ||||
| 3gvd_A | 276 | Crystal Structure Of Serine Acetyltransferase Cyse | 1e-60 | ||
| 1t3d_A | 289 | Crystal Structure Of Serine Acetyltransferase From | 1e-59 | ||
| 1ssq_A | 267 | Serine Acetyltransferase- Complex With Cysteine Len | 3e-58 | ||
| 1sst_A | 267 | Serine Acetyltransferase- Complex With Coa Length = | 3e-58 | ||
| 1s80_A | 278 | Structure Of Serine Acetyltransferase From Haemophi | 3e-57 | ||
| 1ssm_A | 242 | Serine Acetyltransferase- Apoenzyme (Truncated) Len | 4e-57 | ||
| 3mc4_A | 287 | Crystal Structure Of WwRSP5WWP DOMAIN: BACTERIAL TR | 7e-53 | ||
| 3p1b_A | 314 | Crystal Structure Of The Native Serine Acetyltransf | 7e-20 | ||
| 3q1x_A | 313 | Crystal Structure Of Entamoeba Histolytica Serine A | 7e-20 | ||
| 3p47_A | 315 | Crystal Structure Of Entamoeba Histolytica Serine A | 7e-20 | ||
| 3f1x_A | 310 | Three Dimensional Structure Of The Serine Acetyltra | 3e-17 | ||
| 4egg_A | 207 | Computationally Designed Self-Assembling Tetrahedro | 6e-08 | ||
| 4dcl_A | 207 | Computationally Designed Self-Assembling Tetrahedro | 2e-07 | ||
| 3srt_A | 188 | The Crystal Structure Of A Maltose O-Acetyltransfer | 2e-07 | ||
| 3ftt_A | 199 | Crystal Structure Of The Galactoside O-Acetyltransf | 2e-07 | ||
| 3v4e_A | 202 | Crystal Structure Of The Galactoside O-Acetyltransf | 3e-07 | ||
| 1kqa_A | 203 | Galactoside Acetyltransferase In Complex With Coenz | 4e-07 | ||
| 3jqy_B | 252 | Crystal Strucutre Of The Polysia Specific Acetyltra | 2e-05 | ||
| 3fs8_A | 273 | Crystal Structure Of Qdtc, The Dtdp-3-Amino-3,6-Did | 3e-05 | ||
| 4aaw_A | 459 | S.Pneumoniae Glmu In Complex With An Antibacterial | 3e-05 | ||
| 1hm9_A | 468 | Crystal Structure Of S.Pneumoniae N-Acetylglucosami | 4e-05 | ||
| 3hjj_A | 190 | Crystal Structure Of Maltose O-Acetyltransferase Fr | 1e-04 | ||
| 1g95_A | 459 | Crystal Structure Of S.Pneumoniae Glmu, Apo Form Le | 1e-04 | ||
| 3mqg_A | 192 | Crystal Structure Of The 3-N-Acetyl Transferase Wlb | 3e-04 | ||
| 4e6t_A | 294 | Structure Of Lpxa From Acinetobacter Baumannii At 1 | 4e-04 | ||
| 2ic7_A | 185 | Crystal Structure Of Maltose Transacetylase From Ge | 4e-04 | ||
| 4e6u_A | 265 | Structure Of Lpxa From Acinetobacter Baumannii At 1 | 4e-04 | ||
| 1khr_A | 209 | Crystal Structure Of Vat(D) In Complex With Virgini | 6e-04 | ||
| 4ea7_A | 220 | X-Ray Crystal Structure Of Perb From Caulobacter Cr | 7e-04 |
| >pdb|3GVD|A Chain A, Crystal Structure Of Serine Acetyltransferase Cyse From Yersinia Pestis Length = 276 | Back alignment and structure |
|
| >pdb|1T3D|A Chain A, Crystal Structure Of Serine Acetyltransferase From E.Coli At 2.2a Length = 289 | Back alignment and structure |
| >pdb|1SSQ|A Chain A, Serine Acetyltransferase- Complex With Cysteine Length = 267 | Back alignment and structure |
| >pdb|1SST|A Chain A, Serine Acetyltransferase- Complex With Coa Length = 267 | Back alignment and structure |
| >pdb|1S80|A Chain A, Structure Of Serine Acetyltransferase From Haemophilis Influenzae Rd Length = 278 | Back alignment and structure |
| >pdb|1SSM|A Chain A, Serine Acetyltransferase- Apoenzyme (Truncated) Length = 242 | Back alignment and structure |
| >pdb|3MC4|A Chain A, Crystal Structure Of WwRSP5WWP DOMAIN: BACTERIAL TRANSFERASE Hexapeptide Repeat: Serine O-Acetyltransferase From Brucella Melitensis Length = 287 | Back alignment and structure |
| >pdb|3P1B|A Chain A, Crystal Structure Of The Native Serine Acetyltransferase 1 From Entamoeba Histolytica Length = 314 | Back alignment and structure |
| >pdb|3Q1X|A Chain A, Crystal Structure Of Entamoeba Histolytica Serine Acetyltransferase 1 In Complex With L-Serine Length = 313 | Back alignment and structure |
| >pdb|3P47|A Chain A, Crystal Structure Of Entamoeba Histolytica Serine Acetyltransferase 1 In Complex With L-Cysteine Length = 315 | Back alignment and structure |
| >pdb|3F1X|A Chain A, Three Dimensional Structure Of The Serine Acetyltransferase From Bacteroides Vulgatus, Northeast Structural Genomics Consortium Target Bvr62 Length = 310 | Back alignment and structure |
| >pdb|4EGG|A Chain A, Computationally Designed Self-Assembling Tetrahedron Protein, T310 Length = 207 | Back alignment and structure |
| >pdb|4DCL|A Chain A, Computationally Designed Self-Assembling Tetrahedron Protein, T308, Crystallized In Space Group F23 Length = 207 | Back alignment and structure |
| >pdb|3SRT|A Chain A, The Crystal Structure Of A Maltose O-Acetyltransferase From Clostridium Difficile 630 Length = 188 | Back alignment and structure |
| >pdb|3FTT|A Chain A, Crystal Structure Of The Galactoside O-Acetyltransferase From Staphylococcus Aureus Length = 199 | Back alignment and structure |
| >pdb|3V4E|A Chain A, Crystal Structure Of The Galactoside O-Acetyltransferase In Complex With Coa Length = 202 | Back alignment and structure |
| >pdb|1KQA|A Chain A, Galactoside Acetyltransferase In Complex With Coenzyme A Length = 203 | Back alignment and structure |
| >pdb|3JQY|B Chain B, Crystal Strucutre Of The Polysia Specific Acetyltransferase Neuo Length = 252 | Back alignment and structure |
| >pdb|3FS8|A Chain A, Crystal Structure Of Qdtc, The Dtdp-3-Amino-3,6-Dideoxy-D- Glucose N-Acetyl Transferase From Thermoanaerobacterium Thermosaccharolyticum In Complex With Acetyl-Coa Length = 273 | Back alignment and structure |
| >pdb|4AAW|A Chain A, S.Pneumoniae Glmu In Complex With An Antibacterial Inhibitor Length = 459 | Back alignment and structure |
| >pdb|1HM9|A Chain A, Crystal Structure Of S.Pneumoniae N-Acetylglucosamine-1-Phosphate Uridyltransferase, Glmu, Bound To Acetyl Coenzyme A And Udp-N- Acetylglucosamine Length = 468 | Back alignment and structure |
| >pdb|3HJJ|A Chain A, Crystal Structure Of Maltose O-Acetyltransferase From Bacillus Anthracis Length = 190 | Back alignment and structure |
| >pdb|1G95|A Chain A, Crystal Structure Of S.Pneumoniae Glmu, Apo Form Length = 459 | Back alignment and structure |
| >pdb|3MQG|A Chain A, Crystal Structure Of The 3-N-Acetyl Transferase Wlbb From Bo Petrii In Complex With Acetyl-Coa Length = 192 | Back alignment and structure |
| >pdb|4E6T|A Chain A, Structure Of Lpxa From Acinetobacter Baumannii At 1.8a Resolution (P212121 Form) Length = 294 | Back alignment and structure |
| >pdb|2IC7|A Chain A, Crystal Structure Of Maltose Transacetylase From Geobacillus Kaustophilus Length = 185 | Back alignment and structure |
| >pdb|4E6U|A Chain A, Structure Of Lpxa From Acinetobacter Baumannii At 1.4a Resolution (P63 Form) Length = 265 | Back alignment and structure |
| >pdb|1KHR|A Chain A, Crystal Structure Of Vat(D) In Complex With Virginiamycin And Coenzyme A Length = 209 | Back alignment and structure |
| >pdb|4EA7|A Chain A, X-Ray Crystal Structure Of Perb From Caulobacter Crescentus In Complex With Coa And Gdp-Perosamine At 1.0 Angstrom Resolution Length = 220 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 295 | |||
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 1e-150 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 1e-150 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 1e-148 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 3e-66 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 3e-65 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 1e-28 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 2e-27 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 4e-04 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 4e-27 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 3e-06 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 6e-27 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 2e-11 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 2e-08 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 3e-25 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 1e-21 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 1e-20 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 2e-20 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 2e-20 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 2e-20 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 2e-20 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 2e-20 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 2e-20 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 7e-19 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 1e-18 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 4e-06 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 2e-17 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 3e-17 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 3e-17 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 7e-17 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 7e-15 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 1e-14 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 1e-14 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 2e-14 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 3e-14 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 1e-12 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 1e-07 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 1e-12 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 9e-08 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 1e-12 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 9e-08 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 2e-12 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 8e-08 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 2e-12 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 3e-08 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 3e-12 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 1e-06 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 7e-12 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 3e-10 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 2e-07 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 1e-06 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 2e-11 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 4e-10 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 2e-07 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 1e-06 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 3e-11 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 5e-10 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 4e-09 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 2e-06 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 2e-10 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 3e-09 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 6e-09 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 3e-05 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 5e-05 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 4e-04 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 2e-08 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 4e-07 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 2e-05 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 4e-07 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 1e-05 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 5e-07 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 6e-07 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 1e-06 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 3e-06 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 4e-06 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 1e-05 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-05 |
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Length = 287 | Back alignment and structure |
|---|
Score = 421 bits (1084), Expect = e-150
Identities = 123/284 (43%), Positives = 166/284 (58%), Gaps = 10/284 (3%)
Query: 1 MPAGELRYPSPARNLTMETHAAGDDEAWVWAQIKAEARRDAESEPALASYLYSTILSHSS 60
M E + P +A D +W I+AEA ++P L ++LY+TIL+ S
Sbjct: 9 MGTLEAQTQGPGS-----MNAGLDQVDPIWHSIRAEAEEATRNDPVLGAFLYATILNQPS 63
Query: 61 LERSLAFHLGNKLCSSTLLSTLLYDLFLDTFSSDPALRAAAVADLRAARVRDPACVSFSH 120
LE ++ + +L + + +L F ++P D++A RDPA F
Sbjct: 64 LEEAVMHRIAERLGHPDVSADILRQTFDTMLEANPEWSHVLRVDIQAVYDRDPAYSRFMD 123
Query: 121 CLLNYKGFLACQAHRVAHKLWTQSRRPLALALQSRISDVFAVDIHPAAKIGKGILFDHAT 180
+L KGF A Q HR+AH L+ Q R+ A LQSR S +F DIHPAA++G G+ DHAT
Sbjct: 124 PVLYLKGFHAIQTHRLAHWLYKQGRKDFAYYLQSRSSSIFQTDIHPAARLGSGLFLDHAT 183
Query: 181 GVVIGETAVIGNNVSILHHVTLGGTGKASGDRHPKIGDGVLIGAGATILGNVKIGEGAKV 240
G+V+GETAV+ +NVSILH VTLGGTGK+SGDRHPKI GVLIGAGA ILGN+++G+ +K+
Sbjct: 184 GLVVGETAVVEDNVSILHGVTLGGTGKSSGDRHPKIRQGVLIGAGAKILGNIQVGQCSKI 243
Query: 241 GAGSVVLIDVPARATAVGNPARLVGGKEKTSSNEECPGESMDHT 284
AGSVVL VP T G PAR++G + P MD
Sbjct: 244 AAGSVVLKSVPHNVTVAGVPARIIG-----ETGCTEPSRVMDQM 282
|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Length = 289 | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Length = 267 | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Length = 310 | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Length = 313 | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Length = 252 | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* Length = 199 | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Length = 203 | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} PDB: 3ect_A* Length = 195 | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Length = 185 | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} Length = 188 | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} PDB: 3igj_A* Length = 190 | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Length = 182 | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Length = 215 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Length = 219 | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Length = 212 | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Length = 209 | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} Length = 212 | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Length = 173 | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} Length = 187 | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Length = 189 | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Length = 173 | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Length = 191 | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Length = 262 | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Length = 262 | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283 | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283 | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Length = 305 | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Length = 305 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Length = 304 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Length = 334 | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Length = 276 | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Length = 316 | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Length = 247 | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Length = 213 | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Length = 213 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 100.0 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 100.0 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 100.0 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 100.0 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 100.0 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.89 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 99.89 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 99.88 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.88 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 99.87 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.86 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.86 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.82 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.8 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 99.8 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.79 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.79 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.78 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.78 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.77 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 99.77 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 99.77 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.76 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.76 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 99.75 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.75 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.74 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.73 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.73 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 99.72 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.72 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.71 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.71 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.71 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.71 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.71 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.7 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.7 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 99.7 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.69 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.69 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.69 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 99.69 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.68 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.68 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.66 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.66 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.64 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.63 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.63 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.6 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.6 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.6 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.58 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.58 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.57 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.55 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.51 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.5 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.5 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.49 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.48 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 99.47 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.47 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 99.46 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.45 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.45 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.42 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.42 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.41 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.41 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 99.41 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.41 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.4 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.39 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.39 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.39 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.39 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 99.38 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.38 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.38 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.37 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.37 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.33 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.33 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.32 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.32 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.32 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.31 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.3 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.3 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.29 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.29 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.26 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.24 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.24 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.23 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.22 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.21 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.21 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.2 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.19 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.18 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.18 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.16 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.02 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.01 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 98.96 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 98.93 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 98.93 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 98.91 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 98.86 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 98.85 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 98.79 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 98.75 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 98.68 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 98.66 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 98.57 |
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.9e-55 Score=398.32 Aligned_cols=257 Identities=46% Similarity=0.757 Sum_probs=232.9
Q ss_pred CChHHHHHHHHHHHHHhhhcCcchhhhHHHHhcCCCCHHHHHHHHHHHhhcccccchHHHHHHHHHhccCCHHHHHHHHH
Q 039045 24 DDEAWVWAQIKAEARRDAESEPALASYLYSTILSHSSLERSLAFHLGNKLCSSTLLSTLLYDLFLDTFSSDPALRAAAVA 103 (295)
Q Consensus 24 ~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~il~~~~~~~~l~~~la~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~ 103 (295)
...+++|++||+||+..+++||+|++||+.+||+|++|+++|+|+||++|.+..+++..+.+++..++...|++++.+..
T Consensus 27 ~~~~~~w~~~~~ea~~~~~~ep~l~~~~~~~~l~~~~~~~~l~~~l~~~l~~~~~~~~~~~~~~~~~~~~~p~i~~~~~~ 106 (287)
T 3mc4_A 27 DQVDPIWHSIRAEAEEATRNDPVLGAFLYATILNQPSLEEAVMHRIAERLGHPDVSADILRQTFDTMLEANPEWSHVLRV 106 (287)
T ss_dssp GGCCHHHHHHHHHHHHHHHHCGGGHHHHHHHTTTCSSHHHHHHHHHHHHHCCSSSCHHHHHHHHHHHHHHCTTHHHHHHH
T ss_pred ccccHHHHHHHHHHHHHHhhCcHHHHHHHHHhcCCCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHhCHHHHHHHHH
Confidence 34568999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhccCccccccchhhcccchhhHHHHHHHHHHHHhcCChhHHHHHhhccccceeeEeCCCceecCceEEcCCcCeE
Q 039045 104 DLRAARVRDPACVSFSHCLLNYKGFLACQAHRVAHKLWTQSRRPLALALQSRISDVFAVDIHPAAKIGKGILFDHATGVV 183 (295)
Q Consensus 104 dl~~~~~~dpa~~~~~~~~~~~~gf~al~~~r~a~~l~~~~~~~~~~~~~~~~~~~~~v~Ig~~a~IG~~v~I~~~~~v~ 183 (295)
|+.+.+++||++..+..++++|+||+++..||++|++|..++..++..++......++++||+++.||++++|+|+.+++
T Consensus 107 d~~~~~~~DPa~~~~~e~ll~y~G~~al~~yRiah~L~~~g~~~la~~i~~~~~~~~gi~I~p~a~IG~~v~I~hg~gvv 186 (287)
T 3mc4_A 107 DIQAVYDRDPAYSRFMDPVLYLKGFHAIQTHRLAHWLYKQGRKDFAYYLQSRSSSIFQTDIHPAARLGSGLFLDHATGLV 186 (287)
T ss_dssp HHHHHHHHCTTCCCTHHHHHHCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTCCEECTTCEECSSCEEESCTTCE
T ss_pred HHHHHhccCcccCCCCEEEEeCHHHHHHHHHHHHHHHHHcCChhHHHHHHhhceeccCeEECCCCEECCCeEEccCCCeE
Confidence 99999999999999999999999999999999999999999999888888888888999999999999999999999999
Q ss_pred ECCCcEEcCCcEEccCCEECCCCCCCCCCCCEECCCCEECCCCEECCCCEECCCCEECCCCEEcCCCCCCcEEEccCcEE
Q 039045 184 IGETAVIGNNVSILHHVTLGGTGKASGDRHPKIGDGVLIGAGATILGNVKIGEGAKVGAGSVVLIDVPARATAVGNPARL 263 (295)
Q Consensus 184 IG~~~~IG~~v~I~~gv~Igg~~~~~~~~~~~IG~~v~IGa~a~I~~~v~IG~~~~IgagsvV~~~Vp~~~~v~G~PA~~ 263 (295)
||++++||+||.|+++++|++++...+.++++||++|+||+||+|+++++||++|+||+||+|++|||++++++|+|||+
T Consensus 187 IG~~~~IGd~v~I~~gvtIg~~~~~~~~r~~~IGd~v~IGaga~Il~gv~IG~~a~IGagsvV~kdVp~~svvvG~PAki 266 (287)
T 3mc4_A 187 VGETAVVEDNVSILHGVTLGGTGKSSGDRHPKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARI 266 (287)
T ss_dssp ECTTCEECSSCEEETTCEEEC-----CCCSCEECTTCEECTTCEEESSCEECTTCEECTTCEECSCBCTTEEEETTTTEE
T ss_pred ECCCeEECCCCEEcCCCEEcCCcccCCCcCCEECCCCEECCCCEECCCcEECCCCEECCCCEEccccCCCCEEEccCCEE
Confidence 99999999999999999999988888888999999999999999999999999999999999999999999999999999
Q ss_pred ecCCCCCCCCCCCCCccccccc
Q 039045 264 VGGKEKTSSNEECPGESMDHTS 285 (295)
Q Consensus 264 i~~~~~~~~~~~~p~~~~~~~~ 285 (295)
+++.. ...|+..|||.+
T Consensus 267 i~~~~-----~~~p~~~~d~~~ 283 (287)
T 3mc4_A 267 IGETG-----CTEPSRVMDQML 283 (287)
T ss_dssp EEECC-----------------
T ss_pred eCcCC-----CcCcchhhhhhh
Confidence 99876 567999999984
|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 295 | ||||
| d1ssqa_ | 241 | b.81.1.6 (A:) Serine acetyltransferase {Haemophilu | 3e-76 | |
| d1ocxa_ | 182 | b.81.1.3 (A:) Maltose O-acetyltransferase {Escheri | 1e-17 | |
| d1krra_ | 200 | b.81.1.3 (A:) Galactoside acetyltransferase {Esche | 1e-14 | |
| d3tdta_ | 274 | b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytra | 6e-14 | |
| d1g97a1 | 196 | b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha | 5e-13 | |
| d1g97a1 | 196 | b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha | 0.002 | |
| d1g97a1 | 196 | b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha | 0.002 | |
| d1xata_ | 208 | b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudo | 9e-12 | |
| d1mr7a_ | 203 | b.81.1.3 (A:) Xenobiotic acetyltransferase {Entero | 2e-11 | |
| d1mr7a_ | 203 | b.81.1.3 (A:) Xenobiotic acetyltransferase {Entero | 2e-05 | |
| d3bswa1 | 193 | b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylo | 4e-11 | |
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 4e-11 | |
| d2f9ca1 | 320 | b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm | 2e-04 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 2e-10 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 4e-07 | |
| d2oi6a1 | 201 | b.81.1.4 (A:252-452) N-acetylglucosamine 1-phospha | 6e-10 | |
| d2oi6a1 | 201 | b.81.1.4 (A:252-452) N-acetylglucosamine 1-phospha | 4e-04 | |
| d2jf2a1 | 262 | b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra | 5e-08 | |
| d1j2za_ | 259 | b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer | 2e-07 | |
| d1j2za_ | 259 | b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer | 2e-06 | |
| d1v3wa_ | 173 | b.81.1.5 (A:) Ferripyochelin binding protein {Arch | 3e-06 | |
| d1v3wa_ | 173 | b.81.1.5 (A:) Ferripyochelin binding protein {Arch | 7e-06 | |
| d1xhda_ | 172 | b.81.1.5 (A:) Putative acetyltransferase/acyltrans | 3e-06 | |
| d1xhda_ | 172 | b.81.1.5 (A:) Putative acetyltransferase/acyltrans | 8e-05 | |
| d1qrea_ | 210 | b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon M | 1e-05 | |
| d1yp2a1 | 135 | b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt | 2e-04 |
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Length = 241 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded left-handed beta-helix superfamily: Trimeric LpxA-like enzymes family: Serine acetyltransferase domain: Serine acetyltransferase species: Haemophilus influenzae [TaxId: 727]
Score = 230 bits (588), Expect = 3e-76
Identities = 130/236 (55%), Positives = 173/236 (73%)
Query: 29 VWAQIKAEARRDAESEPALASYLYSTILSHSSLERSLAFHLGNKLCSSTLLSTLLYDLFL 88
VW I+ EA+ AE+EP LAS+ +STIL H +L +L++ L NKL + + + L ++
Sbjct: 5 VWQHIRQEAKELAENEPMLASFFHSTILKHQNLGGALSYLLANKLANPIMPAISLREIIE 64
Query: 89 DTFSSDPALRAAAVADLRAARVRDPACVSFSHCLLNYKGFLACQAHRVAHKLWTQSRRPL 148
+ + S+P++ A D++A R RDPA +S LL KGF A Q++R+ H LW Q+R+ L
Sbjct: 65 EAYQSNPSIIDCAACDIQAVRHRDPAVELWSTPLLYLKGFHAIQSYRITHYLWNQNRKSL 124
Query: 149 ALALQSRISDVFAVDIHPAAKIGKGILFDHATGVVIGETAVIGNNVSILHHVTLGGTGKA 208
AL LQ++IS F VDIHPAAKIG GI+FDHATG+V+GET+VI N+VSIL VTLGGTGK
Sbjct: 125 ALYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGTGKE 184
Query: 209 SGDRHPKIGDGVLIGAGATILGNVKIGEGAKVGAGSVVLIDVPARATAVGNPARLV 264
SGDRHPK+ +GV+IGAGA ILGN+++G+ AK+GA SVVL VP ATA G PAR+V
Sbjct: 185 SGDRHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIV 240
|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Length = 182 | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Length = 200 | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Length = 274 | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Length = 208 | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Length = 203 | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Length = 203 | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Length = 193 | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 201 | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 201 | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 173 | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 173 | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Length = 172 | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Length = 172 | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Length = 210 | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 100.0 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.91 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 99.9 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.81 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 99.79 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 99.78 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 99.77 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.76 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.76 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.7 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.7 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.7 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.65 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.63 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.62 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.55 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 99.51 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.44 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.41 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.39 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.36 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 99.11 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.1 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.09 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.09 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.06 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.02 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 98.83 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 98.81 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 98.74 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 98.73 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 98.35 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 97.98 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 97.98 |
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded left-handed beta-helix superfamily: Trimeric LpxA-like enzymes family: Serine acetyltransferase domain: Serine acetyltransferase species: Haemophilus influenzae [TaxId: 727]
Probab=100.00 E-value=3.1e-55 Score=390.76 Aligned_cols=239 Identities=54% Similarity=0.844 Sum_probs=234.5
Q ss_pred HHHHHHHHHHHHHhhhcCcchhhhHHHHhcCCCCHHHHHHHHHHHhhcccccchHHHHHHHHHhccCCHHHHHHHHHHHH
Q 039045 27 AWVWAQIKAEARRDAESEPALASYLYSTILSHSSLERSLAFHLGNKLCSSTLLSTLLYDLFLDTFSSDPALRAAAVADLR 106 (295)
Q Consensus 27 ~~~~~~~~~~~~~~~~~~p~~~~~~~~~il~~~~~~~~l~~~la~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~dl~ 106 (295)
.++|++||+||+..+++||.|++||+..||+|++|+++|+|+||++|.+..+.+..+.+++.+.+..+|++.+.++.|+.
T Consensus 3 ~~iW~~i~~ea~~~~~~EP~L~~~~~~~IL~~~s~~~aLs~~la~kL~~~~~~~~~~~~i~~e~~~~~~~i~~~~~~Dl~ 82 (241)
T d1ssqa_ 3 LDVWQHIRQEAKELAENEPMLASFFHSTILKHQNLGGALSYLLANKLANPIMPAISLREIIEEAYQSNPSIIDCAACDIQ 82 (241)
T ss_dssp HHHHHHHHHHHHHHHHHCHHHHHHHHHHTTTSSSHHHHHHHHHHHHHCBTTBCHHHHHHHHHHHHHHCTHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHHHHhhCcHHHHHHHHhhhcCCCHHHHHHHHHHHHhCCCccchhhHHHHHHHHHhcCHHHHHHHHHHHH
Confidence 45999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhccCccccccchhhcccchhhHHHHHHHHHHHHhcCChhHHHHHhhccccceeeEeCCCceecCceEEcCCcCeEECC
Q 039045 107 AARVRDPACVSFSHCLLNYKGFLACQAHRVAHKLWTQSRRPLALALQSRISDVFAVDIHPAAKIGKGILFDHATGVVIGE 186 (295)
Q Consensus 107 ~~~~~dpa~~~~~~~~~~~~gf~al~~~r~a~~l~~~~~~~~~~~~~~~~~~~~~v~Ig~~a~IG~~v~I~~~~~v~IG~ 186 (295)
+.+.+||+|..+..++++|+||++++.||++||+|..+++.++..++.+....++++||+++.||++++|+|+++++||+
T Consensus 83 a~~~rDpa~~~~~~~~L~~~Gf~Al~~yRiah~l~~~~~~~la~~i~~~~~~~~g~~I~~~~~Ig~g~~i~h~~givig~ 162 (241)
T d1ssqa_ 83 AVRHRDPAVELWSTPLLYLKGFHAIQSYRITHYLWNQNRKSLALYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIVVGE 162 (241)
T ss_dssp HHHHHCTTCCCTHHHHHHCHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHSCEECTTCEECSSCEESSCTTCEECT
T ss_pred HHHccCccccceeeeeehhhhHHHHHHHhhhhhhhhhhhHHHHHHHHHHHhhheeeccccCCEEccCcccCccceEEEec
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CcEEcCCcEEccCCEECCCCCCCCCCCCEECCCCEECCCCEECCCCEECCCCEECCCCEEcCCCCCCcEEEccCcEEec
Q 039045 187 TAVIGNNVSILHHVTLGGTGKASGDRHPKIGDGVLIGAGATILGNVKIGEGAKVGAGSVVLIDVPARATAVGNPARLVG 265 (295)
Q Consensus 187 ~~~IG~~v~I~~gv~Igg~~~~~~~~~~~IG~~v~IGa~a~I~~~v~IG~~~~IgagsvV~~~Vp~~~~v~G~PA~~i~ 265 (295)
++.||+||.|.+++++++++...+.++++||+||+||+||+|++|++||++|+||+||+|++|||++++++|+|||++.
T Consensus 163 ~~~ig~~~~i~~~v~~~~~~~~~~~~~~~Ig~~v~IGaga~Ilg~v~IG~~a~IgAgsvV~kdVp~~~vv~G~PAr~I~ 241 (241)
T d1ssqa_ 163 TSVIENDVSILQGVTLGGTGKESGDRHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVS 241 (241)
T ss_dssp TCEECTTCEECTTCEEECCSSSCSSCSCEECTTCEECTTCEEESSCEECTTCEECTTCEECSCBCTTCEEETTTTEECC
T ss_pred cceecCCeeecccccccccccCCCCCCCccCCCeEECCCCEEcCCcEECCCCEECCCCEECCCCCCCCEEEecCcEEeC
Confidence 9999999999999999999888888999999999999999999999999999999999999999999999999999873
|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|