Citrus Sinensis ID: 039049


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MPEYCVTGGTGFIAAHLVKALLDKGHMVRTTVRDPEDLSKVGFLWELNGAEERLKIMKADLLMEGSFDEAIQGVDGVFHTASPVLVPYDNNIQATLIDPCIKGTLNVLSSCKKAKSVKRVVLTSSCSSIRYRHDAQQVSPLNESHWSDPDYCKHYNLWYAYAKTIAEKEAWRIAKDCGIDMVVVNPSFVVGPLLAPQPTSTLLLILAMVKGLRGEYPNTTVGFVHIDDVVGAHILAMEETRASGRLICSSSVAHWSPIIEMLKATYPSYPYESKCSKQEGDNSPHSMDTSKLFELGFVGFKSVPQ
cccEEEcccccHHHHHHHHHHHHcccCEEEEEcccccHHHHHHHHHcccccccEEEEEccccccccHHHHHccccCEEEccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEccccCEEEEcccccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHcccccccccccccEEEHHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHHHcccccccccccccccccccEEcccHHHHHccccccccccc
MPEYCVTGGTGFIAAHLVKALLDKGHMVRTTVRDPEDLSKVGFLWELNGAEERLKIMKADLLMEGSFDEAIQGVDGVFHTASPVLVPYDNNIQATLIDPCIKGTLNVLSSCKKAKSVKRVVLTSSCSSIRYRHDAQQVSPLNESHWSDPDYCKHYNLWYAYAKTIAEKEAWRIAKDCGIDMVVVNPSFVVGPLLAPQPTSTLLLILAMVKGLRGEYPNTTVGFVHIDDVVGAHILAMEETRASGRLICSSSVAHWSPIIEMLKATYPSYPYESKCSKQEGDNSPHSMDTSKLFELGFVGFKSVP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPEYCVTGGTGFIAAHLVKALLDKGHMVRTTVRDPEDLSKVGFLWELNGAEERLKIMKADLLMEGSFDEAIQGVDGVFHTASPVLVPYDNNIQATLIDPCIKGTLNVLSSCKKAKSVKRVVLTSSCSSIRYRHDAQQVSPLNESHWSDPDYCKHYNLWYAYAKTIAEKEAWRIAKDCGIDMVVVNPSFVVGPLLAPQPTSTLLLILAMVKGLRGEYPNTTVGFVHIDDVVGAHILAMEETRASGRLICSSSVAHWSPIIEMLKATYPSYPYESKCSKQEGDNSPHSMDTSKLFELGFVGFKSVPQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tetraketide alpha-pyrone reductase 2 May be involved in the biosynthesis of hydroxylated tetraketide compounds that serve as sporopollenin precursors (the main constituents of exine). Acts on tetraketide alpha-pyrones and reduces the carbonyl function on the tetraketide alkyl chain to a secondary alcohol function.confidentQ9CA28

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RH8, chain A
Confidence level:very confident
Coverage over the Query: 1-86,97-305
View the alignment between query and template
View the model in PyMOL