Citrus Sinensis ID: 039146

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
AEKVFNHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKYRPTMPVLSVVIPQLKTNQLRWTFT
ccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHccccccEEEEEcccHHEEEEEEEEc
HHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHccccccEEEEEccHHHHHHHHHccc
AEKVFNHNLFFKKVINYvgepmshleSITSSAVRSAIKVKASAIICFTSSGRAARLIAkyrptmpvlsvvipqlktnqlrwtft
aekvfnhnlfFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKYrptmpvlsvvipqlktnqlrwtft
AEKVFNHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKYRPTMPVLSVVIPQLKTNQLRWTFT
***VFNHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKYRPTMPVLSVVIPQLKTNQLRWT**
AEKVFNHNLFFKKVINY****MSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKYRPTMPVLSVVIPQLKTNQLRWTFT
AEKVFNHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKYRPTMPVLSVVIPQLKTNQLRWTFT
*EKVFNHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKYRPTMPVLSVVIPQLKTNQLRWTFT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AEKVFNHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKYRPTMPVLSVVIPQLKTNQLRWTFT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query84 2.2.26 [Sep-21-2011]
Q42954508 Pyruvate kinase, cytosoli N/A no 0.976 0.161 0.475 2e-16
Q42806511 Pyruvate kinase, cytosoli no no 0.976 0.160 0.487 5e-16
P22200510 Pyruvate kinase, cytosoli N/A no 1.0 0.164 0.452 4e-15
O65595497 Probable pyruvate kinase, no no 0.964 0.162 0.407 1e-14
Q27686499 Pyruvate kinase OS=Leishm N/A no 0.976 0.164 0.378 8e-10
P30616499 Pyruvate kinase 2 OS=Tryp N/A no 0.976 0.164 0.365 1e-08
P30615499 Pyruvate kinase 1 OS=Tryp N/A no 0.976 0.164 0.365 1e-08
O44006531 Pyruvate kinase OS=Eimeri N/A no 0.952 0.150 0.337 6e-08
P22360526 Pyruvate kinase OS=Emeric yes no 0.821 0.131 0.376 1e-07
Q12669526 Pyruvate kinase OS=Asperg yes no 0.821 0.131 0.362 4e-07
>sp|Q42954|KPYC_TOBAC Pyruvate kinase, cytosolic isozyme OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function desciption
 Score = 84.7 bits (208), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/82 (47%), Positives = 56/82 (68%)

Query: 1   AEKVFNHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKY 60
           AE   ++   FK++++    PMS LES+ SSAVR+A   KA+ I+  T  G  A+L+AKY
Sbjct: 353 AESTIDYPDVFKRIMSNAPVPMSPLESLASSAVRTANSAKAALILVLTRGGSTAKLVAKY 412

Query: 61  RPTMPVLSVVIPQLKTNQLRWT 82
           RP MP+LSVV+P++KT+   WT
Sbjct: 413 RPGMPILSVVVPEIKTDSFDWT 434

Nicotiana tabacum (taxid: 4097)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 4EC: 0
>sp|Q42806|KPYC_SOYBN Pyruvate kinase, cytosolic isozyme OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|P22200|KPYC_SOLTU Pyruvate kinase, cytosolic isozyme OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|O65595|KPYC_ARATH Probable pyruvate kinase, cytosolic isozyme OS=Arabidopsis thaliana GN=At4g26390 PE=3 SV=1 Back     alignment and function description
>sp|Q27686|KPYK_LEIME Pyruvate kinase OS=Leishmania mexicana GN=PYK PE=1 SV=2 Back     alignment and function description
>sp|P30616|KPYK2_TRYBB Pyruvate kinase 2 OS=Trypanosoma brucei brucei GN=PYK2 PE=3 SV=1 Back     alignment and function description
>sp|P30615|KPYK1_TRYBB Pyruvate kinase 1 OS=Trypanosoma brucei brucei GN=PYK1 PE=3 SV=1 Back     alignment and function description
>sp|O44006|KPYK_EIMTE Pyruvate kinase OS=Eimeria tenella GN=PYK PE=2 SV=1 Back     alignment and function description
>sp|P22360|KPYK_EMENI Pyruvate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pkiA PE=3 SV=2 Back     alignment and function description
>sp|Q12669|KPYK_ASPNG Pyruvate kinase OS=Aspergillus niger GN=pkiA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
388517047 356 unknown [Lotus japonicus] 1.0 0.235 0.857 2e-36
356576333 526 PREDICTED: pyruvate kinase, cytosolic is 1.0 0.159 0.869 3e-36
115484175 527 Os11g0148500 [Oryza sativa Japonica Grou 1.0 0.159 0.845 5e-36
212276127 527 pyruvate kinase isoform 1 [Zea mays] gi| 1.0 0.159 0.845 6e-36
357160930 527 PREDICTED: pyruvate kinase, cytosolic is 1.0 0.159 0.845 6e-36
20562907 491 pyruvate kinase-like [Deschampsia antarc 1.0 0.171 0.833 1e-35
356503001 584 PREDICTED: pyruvate kinase, cytosolic is 1.0 0.143 0.845 1e-35
356535537 526 PREDICTED: pyruvate kinase, cytosolic is 1.0 0.159 0.857 1e-35
297740039 514 unnamed protein product [Vitis vinifera] 1.0 0.163 0.833 1e-35
356505306 527 PREDICTED: pyruvate kinase, cytosolic is 1.0 0.159 0.833 1e-35
>gi|388517047|gb|AFK46585.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/84 (85%), Positives = 79/84 (94%)

Query: 1   AEKVFNHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKY 60
           AEKV+NH+ +FKK + +VGEPMSHLESI SSAVR+AIKVKAS IICFTSSGRAARLIAKY
Sbjct: 199 AEKVYNHDWYFKKTVKHVGEPMSHLESIASSAVRAAIKVKASVIICFTSSGRAARLIAKY 258

Query: 61  RPTMPVLSVVIPQLKTNQLRWTFT 84
           RPTMPV+SVVIPQLKTNQLRWTFT
Sbjct: 259 RPTMPVISVVIPQLKTNQLRWTFT 282

Source: Lotus japonicus

Species: Lotus japonicus

Genus: Lotus

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356576333|ref|XP_003556287.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Glycine max] Back     alignment and taxonomy information
>gi|115484175|ref|NP_001065749.1| Os11g0148500 [Oryza sativa Japonica Group] gi|77548686|gb|ABA91483.1| pyruvate kinase family protein, expressed [Oryza sativa Japonica Group] gi|113644453|dbj|BAF27594.1| Os11g0148500 [Oryza sativa Japonica Group] gi|215692631|dbj|BAG88051.1| unnamed protein product [Oryza sativa Japonica Group] gi|218185248|gb|EEC67675.1| hypothetical protein OsI_35105 [Oryza sativa Indica Group] gi|222615524|gb|EEE51656.1| hypothetical protein OsJ_32969 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|212276127|ref|NP_001130515.1| pyruvate kinase isoform 1 [Zea mays] gi|194689354|gb|ACF78761.1| unknown [Zea mays] gi|195635013|gb|ACG36975.1| pyruvate kinase, cytosolic isozyme [Zea mays] gi|223947285|gb|ACN27726.1| unknown [Zea mays] gi|238009496|gb|ACR35783.1| unknown [Zea mays] gi|413924868|gb|AFW64800.1| pyruvate kinase isoform 1 [Zea mays] gi|413924869|gb|AFW64801.1| pyruvate kinase isoform 2 [Zea mays] Back     alignment and taxonomy information
>gi|357160930|ref|XP_003578922.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|20562907|gb|AAM22747.1| pyruvate kinase-like [Deschampsia antarctica] Back     alignment and taxonomy information
>gi|356503001|ref|XP_003520302.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Glycine max] Back     alignment and taxonomy information
>gi|356535537|ref|XP_003536301.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Glycine max] Back     alignment and taxonomy information
>gi|297740039|emb|CBI30221.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356505306|ref|XP_003521432.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
TAIR|locus:2044928527 AT2G36580 [Arabidopsis thalian 1.0 0.159 0.833 4.6e-33
TAIR|locus:2085226527 AT3G52990 [Arabidopsis thalian 1.0 0.159 0.809 8e-33
TAIR|locus:2161068498 AT5G56350 [Arabidopsis thalian 0.976 0.164 0.475 5.3e-15
TAIR|locus:2159577510 AT5G08570 [Arabidopsis thalian 0.976 0.160 0.475 1.5e-14
TAIR|locus:2160599510 AT5G63680 [Arabidopsis thalian 0.976 0.160 0.475 1.5e-14
TAIR|locus:2131453497 AT4G26390 [Arabidopsis thalian 0.964 0.162 0.407 3.7e-13
TAIR|locus:2092085497 AT3G25960 [Arabidopsis thalian 0.880 0.148 0.432 1.2e-11
TAIR|locus:2095953510 AT3G04050 [Arabidopsis thalian 0.976 0.160 0.373 1.3e-11
TAIR|locus:2078966510 AT3G55650 [Arabidopsis thalian 0.880 0.145 0.418 1.6e-11
TAIR|locus:2078956492 AT3G55810 [Arabidopsis thalian 0.880 0.150 0.405 3.2e-11
TAIR|locus:2044928 AT2G36580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 361 (132.1 bits), Expect = 4.6e-33, P = 4.6e-33
 Identities = 70/84 (83%), Positives = 78/84 (92%)

Query:     1 AEKVFNHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKY 60
             AEKVFN +LFFKK + YVGEPM+HLESI SSAVR+AIKVKAS IICFTSSGRAARLIAKY
Sbjct:   370 AEKVFNQDLFFKKTVKYVGEPMTHLESIASSAVRAAIKVKASVIICFTSSGRAARLIAKY 429

Query:    61 RPTMPVLSVVIPQLKTNQLRWTFT 84
             RPTMPVLSVVIP+L TNQL+W+F+
Sbjct:   430 RPTMPVLSVVIPRLTTNQLKWSFS 453
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004743 "pyruvate kinase activity" evidence=IEA;ISS
GO:0006096 "glycolysis" evidence=IEA;ISS
GO:0030955 "potassium ion binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2085226 AT3G52990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161068 AT5G56350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159577 AT5G08570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160599 AT5G63680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131453 AT4G26390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092085 AT3G25960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095953 AT3G04050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078966 AT3G55650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078956 AT3G55810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
PLN02765526 PLN02765, PLN02765, pyruvate kinase 4e-53
PLN02461511 PLN02461, PLN02461, Probable pyruvate kinase 2e-29
cd00288480 cd00288, Pyruvate_Kinase, Pyruvate kinase (PK): La 3e-18
pfam02887117 pfam02887, PK_C, Pyruvate kinase, alpha/beta domai 2e-15
TIGR01064473 TIGR01064, pyruv_kin, pyruvate kinase 4e-14
PTZ00066513 PTZ00066, PTZ00066, pyruvate kinase; Provisional 4e-14
PTZ00300454 PTZ00300, PTZ00300, pyruvate kinase; Provisional 5e-13
COG0469477 COG0469, PykF, Pyruvate kinase [Carbohydrate trans 2e-12
PRK09206470 PRK09206, PRK09206, pyruvate kinase; Provisional 5e-08
PRK05826465 PRK05826, PRK05826, pyruvate kinase; Provisional 1e-07
PRK06354 590 PRK06354, PRK06354, pyruvate kinase; Provisional 3e-07
PRK06247476 PRK06247, PRK06247, pyruvate kinase; Provisional 6e-05
PLN02762509 PLN02762, PLN02762, pyruvate kinase complex alpha 0.004
>gnl|CDD|215409 PLN02765, PLN02765, pyruvate kinase Back     alignment and domain information 
 Score =  171 bits (436), Expect = 4e-53
 Identities = 71/84 (84%), Positives = 78/84 (92%)

Query: 1   AEKVFNHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKY 60
           AEKVFN +L+FKK + YVGEPMSHLESI SSAVR+AIKVKAS II FTSSGRAARLIAKY
Sbjct: 369 AEKVFNQDLYFKKTVKYVGEPMSHLESIASSAVRAAIKVKASVIIVFTSSGRAARLIAKY 428

Query: 61  RPTMPVLSVVIPQLKTNQLRWTFT 84
           RPTMPVLSVVIP+LKTNQL+W+FT
Sbjct: 429 RPTMPVLSVVIPRLKTNQLKWSFT 452

Length = 526
>gnl|CDD|215255 PLN02461, PLN02461, Probable pyruvate kinase Back     alignment and domain information
>gnl|CDD|238178 cd00288, Pyruvate_Kinase, Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors Back     alignment and domain information
>gnl|CDD|217269 pfam02887, PK_C, Pyruvate kinase, alpha/beta domain Back     alignment and domain information
>gnl|CDD|233257 TIGR01064, pyruv_kin, pyruvate kinase Back     alignment and domain information
>gnl|CDD|173361 PTZ00066, PTZ00066, pyruvate kinase; Provisional Back     alignment and domain information
>gnl|CDD|140321 PTZ00300, PTZ00300, pyruvate kinase; Provisional Back     alignment and domain information
>gnl|CDD|223545 COG0469, PykF, Pyruvate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|181699 PRK09206, PRK09206, pyruvate kinase; Provisional Back     alignment and domain information
>gnl|CDD|235619 PRK05826, PRK05826, pyruvate kinase; Provisional Back     alignment and domain information
>gnl|CDD|235784 PRK06354, PRK06354, pyruvate kinase; Provisional Back     alignment and domain information
>gnl|CDD|180487 PRK06247, PRK06247, pyruvate kinase; Provisional Back     alignment and domain information
>gnl|CDD|215407 PLN02762, PLN02762, pyruvate kinase complex alpha subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 84
PF02887117 PK_C: Pyruvate kinase, alpha/beta domain; InterPro 99.84
PTZ00066513 pyruvate kinase; Provisional 99.8
PTZ00300454 pyruvate kinase; Provisional 99.79
PLN02461511 Probable pyruvate kinase 99.77
TIGR01064473 pyruv_kin pyruvate kinase. This enzyme is a homote 99.76
PLN02765526 pyruvate kinase 99.76
PRK06247476 pyruvate kinase; Provisional 99.75
PRK09206470 pyruvate kinase; Provisional 99.74
PRK06354 590 pyruvate kinase; Provisional 99.74
PLN02762509 pyruvate kinase complex alpha subunit 99.73
PRK05826465 pyruvate kinase; Provisional 99.72
cd00288480 Pyruvate_Kinase Pyruvate kinase (PK): Large allost 99.72
PLN02623581 pyruvate kinase 99.69
COG0469477 PykF Pyruvate kinase [Carbohydrate transport and m 99.64
KOG2323501 consensus Pyruvate kinase [Carbohydrate transport 99.63
COG1751 186 Uncharacterized conserved protein [Function unknow 95.21
PF00582140 Usp: Universal stress protein family; InterPro: IP 89.05
PRK04885265 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 88.71
KOG2178409 consensus Predicted sugar kinase [Carbohydrate tra 86.59
PRK15005144 universal stress protein F; Provisional 86.36
PRK01231295 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 83.8
cd05008126 SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repea 83.73
cd01987124 USP_OKCHK USP domain is located between the N-term 81.9
COG0061281 nadF NAD kinase [Coenzyme metabolism] 81.78
PRK02649305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 81.7
PRK04539296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 81.43
PLN02935508 Bifunctional NADH kinase/NAD(+) kinase 81.28
PRK13509 251 transcriptional repressor UlaR; Provisional 81.03
PRK02645305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 80.78
PRK10411 240 DNA-binding transcriptional activator FucR; Provis 80.66
PF00455161 DeoRC: DeoR C terminal sensor domain; InterPro: IP 80.03
>PF02887 PK_C: Pyruvate kinase, alpha/beta domain; InterPro: IPR015795 Pyruvate kinase (2 Back     alignment and domain information 
Probab=99.84  E-value=3.1e-21  Score=121.68  Aligned_cols=59  Identities=42%  Similarity=0.642  Sum_probs=55.4

Q ss_pred             HHHHHHHHHHHHHhcCCcEEEEecCCchHHHHHHhhCCCCCEEEEecChhhhccccccc
Q 039146           25 LESITSSAVRSAIKVKASAIICFTSSGRAARLIAKYRPTMPVLSVVIPQLKTNQLRWTF   83 (84)
Q Consensus        25 ~~~ia~~a~~~a~~~~~~aIv~~T~sG~ta~~iS~~Rp~~pIia~t~~~~~~r~L~l~~   83 (84)
                      +|+++.+++.+|.++++++||++|.||+||+++|||||++|||++|+++.++|+|+|.+
T Consensus         1 Teaia~aa~~~A~~~~ak~Ivv~T~sG~ta~~isk~RP~~pIiavt~~~~~~r~l~l~~   59 (117)
T PF02887_consen    1 TEAIARAAVELAEDLNAKAIVVFTESGRTARLISKYRPKVPIIAVTPNESVARQLSLYW   59 (117)
T ss_dssp             HHHHHHHHHHHHHHHTESEEEEE-SSSHHHHHHHHT-TSSEEEEEESSHHHHHHGGGST
T ss_pred             CHHHHHHHHHHHHhcCCCEEEEECCCchHHHHHHhhCCCCeEEEEcCcHHHHhhhhccc
Confidence            58999999999999999999999999999999999999999999999999999999976

7.1.40 from EC) (PK) catalyses the final step in glycolysis [], the conversion of phosphoenolpyruvate to pyruvate with concomitant phosphorylation of ADP to ATP: ADP + phosphoenolpyruvate = ATP + pyruvate The enzyme, which is found in all living organisms, requires both magnesium and potassium ions for its activity. In vertebrates, there are four tissue-specific isozymes: L (liver), R (red cells), M1 (muscle, heart and brain), and M2 (early foetal tissue). In plants, PK exists as cytoplasmic and plastid isozymes, while most bacteria and lower eukaryotes have one form, except in certain bacteria, such as Escherichia coli, that have two isozymes. All isozymes appear to be tetramers of identical subunits of ~500 residues. PK helps control the rate of glycolysis, along with phosphofructokinase (IPR000023 from INTERPRO) and hexokinase (IPR001312 from INTERPRO). PK possesses allosteric sites for numerous effectors, yet the isozymes respond differently, in keeping with their different tissue distributions []. The activity of L-type (liver) PK is increased by fructose-1,6-bisphosphate (F1,6BP) and lowered by ATP and alanine (gluconeogenic precursor), therefore when glucose levels are high, glycolysis is promoted, and when levels are low, gluconeogenesis is promoted. L-type PK is also hormonally regulated, being activated by insulin and inhibited by glucagon, which covalently modifies the PK enzyme. M1-type (muscle, brain) PK is inhibited by ATP, but F1,6BP and alanine have no effect, which correlates with the function of muscle and brain, as opposed to the liver. The structure of several pyruvate kinases from various organisms have been determined [, ]. The protein comprises three-four domains: a small N-terminal helical domain (absent in bacterial PK), a beta/alpha-barrel domain, a beta-barrel domain (inserted within the beta/alpha-barrel domain), and a 3-layer alpha/beta/alpha sandwich domain. This entry represents the 3-layer alpha/beta/alpha sandwich domain. This domain has a similar topology to the archaeal hypothetical protein, MTH1675 from Methanobacterium thermoautotrophicum.; PDB: 3QTG_B 1VP8_A 1T57_C 3N25_A 1AQF_C 2G50_B 1F3X_G 1A5U_F 1A49_E 1F3W_C ....
>PTZ00066 pyruvate kinase; Provisional Back     alignment and domain information
>PTZ00300 pyruvate kinase; Provisional Back     alignment and domain information
>PLN02461 Probable pyruvate kinase Back     alignment and domain information
>TIGR01064 pyruv_kin pyruvate kinase Back     alignment and domain information
>PLN02765 pyruvate kinase Back     alignment and domain information
>PRK06247 pyruvate kinase; Provisional Back     alignment and domain information
>PRK09206 pyruvate kinase; Provisional Back     alignment and domain information
>PRK06354 pyruvate kinase; Provisional Back     alignment and domain information
>PLN02762 pyruvate kinase complex alpha subunit Back     alignment and domain information
>PRK05826 pyruvate kinase; Provisional Back     alignment and domain information
>cd00288 Pyruvate_Kinase Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors Back     alignment and domain information
>PLN02623 pyruvate kinase Back     alignment and domain information
>COG0469 PykF Pyruvate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2323 consensus Pyruvate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1751 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>KOG2178 consensus Predicted sugar kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>cd05008 SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>COG0061 nadF NAD kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PLN02935 Bifunctional NADH kinase/NAD(+) kinase Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>PF00455 DeoRC: DeoR C terminal sensor domain; InterPro: IPR014036 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
3pp7_A498 Crystal Structure Of Leishmania Mexicana Pyruvate K 6e-11
3e0v_A539 Crystal Structure Of Pyruvate Kinase From Leishmani 6e-11
1pkl_A499 The Structure Of Leishmania Pyruvate Kinase Length 6e-11
3khd_A520 Crystal Structure Of Pff1300w. Length = 520 1e-09
3qv9_A499 Crystal Structure Of Trypanosoma Cruzi Pyruvate Kin 4e-09
3eoe_A511 Crystal Structure Of Pyruvate Kinase From Toxoplasm 1e-07
3ma8_A534 Crystal Structure Of Cgd1_2040, A Pyruvate Kinase F 4e-07
4drs_A526 Crystal Structure Of Cryptosporidium Parvum Pyruvat 4e-07
3srf_C551 Human M1 Pyruvate Kinase Length = 551 1e-06
1pkm_A530 The Refined Three-Dimensional Structure Of Cat Musc 2e-06
3n25_A531 The Structure Of Muscle Pyruvate Kinase In Complex 2e-06
2g50_A530 The Location Of The Allosteric Amino Acid Binding S 2e-06
1aqf_A530 Pyruvate Kinase From Rabbit Muscle With Mg, K, And 4e-06
1f3w_A530 Recombinant Rabbit Muscle Pyruvate Kinase Length = 4e-06
1pkn_A530 Structure Of Rabbit Muscle Pyruvate Kinase Complexe 4e-06
1f3x_A530 S402p Mutant Of Rabbit Muscle Pyruvate Kinase Lengt 7e-06
4ima_A543 The Structure Of C436m-hlpyk In Complex With Citrat 4e-05
4ip7_A543 Structure Of The S12d Variant Of Human Liver Pyruva 6e-05
2vgf_A528 Human Erythrocyte Pyruvate Kinase: T384m Mutant Len 6e-05
2vgb_A528 Human Erythrocyte Pyruvate Kinase Length = 528 6e-05
4b2d_D548 Human Pkm2 With L-serine And Fbp Bound Length = 548 8e-05
3gqy_A550 Activator-Bound Structure Of Human Pyruvate Kinase 8e-05
1t5a_A567 Human Pyruvate Kinase M2 Length = 567 8e-05
3srd_A551 Human M2 Pyruvate Kinase In Complex With Fructose 1 8e-05
1zjh_A548 Structure Of Human Muscle Pyruvate Kinase (Pkm2) Le 8e-05
4g1n_A518 Pkm2 In Complex With An Activator Length = 518 8e-05
3bjf_A518 Pyruvate Kinase M2 Is A Phosphotyrosine Binding Pro 8e-05
3u2z_A533 Activator-Bound Structure Of Human Pyruvate Kinase 8e-05
3bjt_A530 Pyruvate Kinase M2 Is A Phosphotyrosine Binding Pro 9e-05
3g2g_A533 S437y Mutant Of Human Muscle Pyruvate Kinase, Isofo 2e-04
2vgi_A528 Human Erythrocyte Pyruvate Kinase: R486w Mutant Len 3e-04
1a3w_A500 Pyruvate Kinase From Saccharomyces Cerevisiae Compl 3e-04
2vgg_A528 Human Erythrocyte Pyruvate Kinase: R479h Mutant Len 3e-04
2e28_A 587 Crystal Structure Analysis Of Pyruvate Kinase From 7e-04
>pdb|3PP7|A Chain A, Crystal Structure Of Leishmania Mexicana Pyruvate Kinase In Complex With The Drug Suramin, An Inhibitor Of Glycolysis. Length = 498 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 46/82 (56%)
Query: 1   AEKVFNHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKY 60
           A+   N  +FF  +      PMS  E++ SSAV S  + KA A++  +++GR+ARL+AKY
Sbjct: 353 AQSALNEYVFFNSIKKLQHIPMSADEAVCSSAVNSVYETKAKAMVVLSNTGRSARLVAKY 412
Query: 61  RPTMPVLSVVIPQLKTNQLRWT 82
           RP  P++ V        QL  T
Sbjct: 413 RPNCPIVCVTTRLQTCRQLNIT 434
>pdb|3E0V|A Chain A, Crystal Structure Of Pyruvate Kinase From Leishmania Mexicana In Complex With Sulphate Ions Length = 539 Back     alignment and structure
>pdb|1PKL|A Chain A, The Structure Of Leishmania Pyruvate Kinase Length = 499 Back     alignment and structure
>pdb|3KHD|A Chain A, Crystal Structure Of Pff1300w. Length = 520 Back     alignment and structure
>pdb|3QV9|A Chain A, Crystal Structure Of Trypanosoma Cruzi Pyruvate Kinase(Tcpyk)in Complex With Ponceau S. Length = 499 Back     alignment and structure
>pdb|3EOE|A Chain A, Crystal Structure Of Pyruvate Kinase From Toxoplasma Gondii, 55.M00007 Length = 511 Back     alignment and structure
>pdb|3MA8|A Chain A, Crystal Structure Of Cgd1_2040, A Pyruvate Kinase From Cryptosporidium Parvum Length = 534 Back     alignment and structure
>pdb|4DRS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Pyruvate Kinase Length = 526 Back     alignment and structure
>pdb|3SRF|C Chain C, Human M1 Pyruvate Kinase Length = 551 Back     alignment and structure
>pdb|1PKM|A Chain A, The Refined Three-Dimensional Structure Of Cat Muscle (M1) Pyruvate Kinase, At A Resolution Of 2.6 Angstroms Length = 530 Back     alignment and structure
>pdb|3N25|A Chain A, The Structure Of Muscle Pyruvate Kinase In Complex With Proline, Pyruvate, And Mn2+ Length = 531 Back     alignment and structure
>pdb|2G50|A Chain A, The Location Of The Allosteric Amino Acid Binding Site Of Muscle Pyruvate Kinase. Length = 530 Back     alignment and structure
>pdb|1AQF|A Chain A, Pyruvate Kinase From Rabbit Muscle With Mg, K, And L- Phospholactate Length = 530 Back     alignment and structure
>pdb|1F3W|A Chain A, Recombinant Rabbit Muscle Pyruvate Kinase Length = 530 Back     alignment and structure
>pdb|1PKN|A Chain A, Structure Of Rabbit Muscle Pyruvate Kinase Complexed With Mn2+, K+, And Pyruvate Length = 530 Back     alignment and structure
>pdb|1F3X|A Chain A, S402p Mutant Of Rabbit Muscle Pyruvate Kinase Length = 530 Back     alignment and structure
>pdb|4IMA|A Chain A, The Structure Of C436m-hlpyk In Complex With Citrate/mn/atp/fru-1,6-bp Length = 543 Back     alignment and structure
>pdb|4IP7|A Chain A, Structure Of The S12d Variant Of Human Liver Pyruvate Kinase In Complex With Citrate And Fbp. Length = 543 Back     alignment and structure
>pdb|2VGF|A Chain A, Human Erythrocyte Pyruvate Kinase: T384m Mutant Length = 528 Back     alignment and structure
>pdb|2VGB|A Chain A, Human Erythrocyte Pyruvate Kinase Length = 528 Back     alignment and structure
>pdb|4B2D|D Chain D, Human Pkm2 With L-serine And Fbp Bound Length = 548 Back     alignment and structure
>pdb|3GQY|A Chain A, Activator-Bound Structure Of Human Pyruvate Kinase M2 Length = 550 Back     alignment and structure
>pdb|1T5A|A Chain A, Human Pyruvate Kinase M2 Length = 567 Back     alignment and structure
>pdb|3SRD|A Chain A, Human M2 Pyruvate Kinase In Complex With Fructose 1-6 Bisphosphate And Oxalate. Length = 551 Back     alignment and structure
>pdb|1ZJH|A Chain A, Structure Of Human Muscle Pyruvate Kinase (Pkm2) Length = 548 Back     alignment and structure
>pdb|4G1N|A Chain A, Pkm2 In Complex With An Activator Length = 518 Back     alignment and structure
>pdb|3BJF|A Chain A, Pyruvate Kinase M2 Is A Phosphotyrosine Binding Protein Length = 518 Back     alignment and structure
>pdb|3U2Z|A Chain A, Activator-Bound Structure Of Human Pyruvate Kinase M2 Length = 533 Back     alignment and structure
>pdb|3BJT|A Chain A, Pyruvate Kinase M2 Is A Phosphotyrosine Binding Protein Length = 530 Back     alignment and structure
>pdb|3G2G|A Chain A, S437y Mutant Of Human Muscle Pyruvate Kinase, Isoform M2 Length = 533 Back     alignment and structure
>pdb|2VGI|A Chain A, Human Erythrocyte Pyruvate Kinase: R486w Mutant Length = 528 Back     alignment and structure
>pdb|1A3W|A Chain A, Pyruvate Kinase From Saccharomyces Cerevisiae Complexed With Fbp, Pg, Mn2+ And K+ Length = 500 Back     alignment and structure
>pdb|2VGG|A Chain A, Human Erythrocyte Pyruvate Kinase: R479h Mutant Length = 528 Back     alignment and structure
>pdb|2E28|A Chain A, Crystal Structure Analysis Of Pyruvate Kinase From Bacillus Stearothermophilus Length = 587 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
3khd_A520 Pyruvate kinase; malaria, structural genomics, str 2e-20
3hqn_D499 Pyruvate kinase, PK; TIM barrel, T-state enzyme, t 2e-20
3gg8_A511 Pyruvate kinase; malaria, genomics, proteomics, gl 3e-20
3ma8_A534 Pyruvate kinase; parasitology, pyruvate kiase, gly 3e-20
1a3w_A500 Pyruvate kinase; allosteric regulation, tranferase 6e-20
3gr4_A550 Pyruvate kinase isozymes M1/M2; activator, acetyla 1e-19
3t05_A 606 Pyruvate kinase, PK; tetramer, glycolysis, transfe 1e-17
1e0t_A470 Pyruvate kinase, PK; phosphotransferase, glycolysi 2e-17
2e28_A 587 Pyruvate kinase, PK; allosteric, transferase; 2.40 2e-16
3qtg_A461 Pyruvate kinase, PK; TIM barrel, glycolysis, trans 8e-12
>3khd_A Pyruvate kinase; malaria, structural genomics, structural GE consortium, SGC, transferase; 2.70A {Plasmodium falciparum 3D7} Length = 520 Back     alignment and structure
 Score = 82.2 bits (204), Expect = 2e-20
 Identities = 26/69 (37%), Positives = 45/69 (65%)

Query: 1   AEKVFNHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKY 60
           AE   ++ L ++ ++N +  P+S  E++  SAV +A  ++AS II  T +G  ARLIAKY
Sbjct: 379 AEACIDYKLLYQSLVNAIETPISVQEAVARSAVETAESIQASLIIALTETGYTARLIAKY 438

Query: 61  RPTMPVLSV 69
           +P+  +L++
Sbjct: 439 KPSCTILAL 447
>3hqn_D Pyruvate kinase, PK; TIM barrel, T-state enzyme, transferase, allosteric enzyme, binding, glycolysis, magnesium, metal-binding, NUCL binding; 2.00A {Leishmania mexicana} PDB: 1pkl_A 3hqo_K* 3hqp_A* 3hqq_A* 3is4_A* 3ktx_A* 3qv6_A* 3qv7_D* 3qv8_D* 3e0w_A 3e0v_A 3pp7_A* 3qv9_A* Length = 499 Back     alignment and structure
>3gg8_A Pyruvate kinase; malaria, genomics, proteomics, glycolysis, magnesium, transferase, structural genomics, STRU genomics consortium, SGC; 2.21A {Toxoplasma gondii} PDB: 3eoe_A Length = 511 Back     alignment and structure
>3ma8_A Pyruvate kinase; parasitology, pyruvate kiase, glycol kinase, magnesium, transferase, structural genomi structural genomics consortium; HET: CIT; 2.64A {Cryptosporidium parvum} Length = 534 Back     alignment and structure
>1a3w_A Pyruvate kinase; allosteric regulation, tranferase, transfer; HET: FBP; 3.00A {Saccharomyces cerevisiae} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1a3x_A Length = 500 Back     alignment and structure
>3gr4_A Pyruvate kinase isozymes M1/M2; activator, acetylation, allosteric enzyme, alternative splicing, glycolysis, magnesium, metal-binding; HET: FBP TLA DYY ADP; 1.60A {Homo sapiens} PDB: 3gqy_A* 3h6o_A* 3me3_A* 1zjh_A 3g2g_A 1t5a_A* 3bjt_A 3bjf_A* 1f3x_A 3n25_A 1f3w_A 1a49_A* 1a5u_A* 1aqf_A* 1pkm_A 2g50_A* 1pkn_A 2vgb_A* 2vgf_A* 2vgg_A* ... Length = 550 Back     alignment and structure
>3t05_A Pyruvate kinase, PK; tetramer, glycolysis, transferase; 3.05A {Staphylococcus aureus subsp} PDB: 3t07_A* Length = 606 Back     alignment and structure
>1e0t_A Pyruvate kinase, PK; phosphotransferase, glycolysis, allostery; 1.8A {Escherichia coli} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1pky_A 1e0u_A Length = 470 Back     alignment and structure
>2e28_A Pyruvate kinase, PK; allosteric, transferase; 2.40A {Geobacillus stearothermophilus} Length = 587 Back     alignment and structure
>3qtg_A Pyruvate kinase, PK; TIM barrel, glycolysis, transferase; 2.20A {Pyrobaculum aerophilum} Length = 461 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
4drs_A526 Pyruvate kinase; glycolysis, allosteric EN transfe 99.84
3hqn_D499 Pyruvate kinase, PK; TIM barrel, T-state enzyme, t 99.84
3gr4_A550 Pyruvate kinase isozymes M1/M2; activator, acetyla 99.83
3khd_A520 Pyruvate kinase; malaria, structural genomics, str 99.83
3gg8_A511 Pyruvate kinase; malaria, genomics, proteomics, gl 99.83
1a3w_A500 Pyruvate kinase; allosteric regulation, tranferase 99.81
3t05_A 606 Pyruvate kinase, PK; tetramer, glycolysis, transfe 99.78
2e28_A 587 Pyruvate kinase, PK; allosteric, transferase; 2.40 99.77
1e0t_A470 Pyruvate kinase, PK; phosphotransferase, glycolysi 99.76
3qtg_A461 Pyruvate kinase, PK; TIM barrel, glycolysis, trans 99.74
1vp8_A 201 Hypothetical protein AF0103; putative pyruvate kin 96.43
1t57_A 206 Conserved protein MTH1675; structural genomics, FM 96.06
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 88.91
2z08_A137 Universal stress protein family; uncharacterized c 87.8
3tnj_A150 Universal stress protein (USP); structural genomic 87.18
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 85.66
3dlo_A155 Universal stress protein; unknown function, struct 83.94
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 83.09
3s3t_A146 Nucleotide-binding protein, universal stress PROT 82.18
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 82.05
3fdx_A143 Putative filament protein / universal stress PROT; 81.84
1q77_A138 Hypothetical protein AQ_178; structural genomics, 81.62
3pfn_A365 NAD kinase; structural genomics consortium, SNP, S 81.56
2xhz_A183 KDSD, YRBH, arabinose 5-phosphate isomerase; lipop 80.79
>4drs_A Pyruvate kinase; glycolysis, allosteric EN transferase; 2.50A {Cryptosporidium parvum} PDB: 3ma8_A* Back     alignment and structure
Probab=99.84  E-value=3.5e-21  Score=145.79  Aligned_cols=83  Identities=31%  Similarity=0.458  Sum_probs=78.9

Q ss_pred             CCcccchHHHHHHHHhhcCCCCCHHHHHHHHHHHHHHhcCCcEEEEecCCchHHHHHHhhCCCCCEEEEecChhhhcccc
Q 039146            1 AEKVFNHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKYRPTMPVLSVVIPQLKTNQLR   80 (84)
Q Consensus         1 aE~~~~~~~~~~~~~~~~~~~~~~~~~ia~~a~~~a~~~~~~aIv~~T~sG~ta~~iS~~Rp~~pIia~t~~~~~~r~L~   80 (84)
                      +|+.++|+.+|+.+....+.+.+..++||.+++.+|.++++++||++|.||+||+++|||||.+||||+|++++++|+|+
T Consensus       385 aE~~~~~~~~~~~~~~~~~~~~~~~~aia~aa~~~A~~l~a~aIv~~T~sG~tA~~iSr~RP~~pI~a~T~~~~~~r~l~  464 (526)
T 4drs_A          385 AETCIDYPVLYHAIHSSVPKPVAVPEAIACSAVESAHDVNAKLIITITETGNTARLISKYRPSQTIIACTAKPEVARGLK  464 (526)
T ss_dssp             HHTTCCHHHHHHHHHHHSCSSCCHHHHHHHHHHHHHHHTTCSEEEEECSSSHHHHHHHHTCCSSEEEEEESCHHHHHHGG
T ss_pred             HhhcccchhhhhhhhhccCCCCCHHHHHHHHHHHHHHhCCCCEEEEECCCcHHHHHHHhhCCCCCEEEECCCHHHHHhhh
Confidence            48889999999888888888889999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccc
Q 039146           81 WTF   83 (84)
Q Consensus        81 l~~   83 (84)
                      |.+
T Consensus       465 L~w  467 (526)
T 4drs_A          465 IAR  467 (526)
T ss_dssp             GST
T ss_pred             ccC
Confidence            976
>3hqn_D Pyruvate kinase, PK; TIM barrel, T-state enzyme, transferase, allosteric enzyme, binding, glycolysis, magnesium, metal-binding, NUCL binding; 2.00A {Leishmania mexicana} PDB: 1pkl_A 3hqo_K* 3hqp_A* 3hqq_A* 3is4_A* 3ktx_A* 3qv6_A* 3qv7_D* 3qv8_D* 3srk_A* 3e0w_A 3e0v_A 3pp7_A* 3qv9_A* Back     alignment and structure
>3gr4_A Pyruvate kinase isozymes M1/M2; activator, acetylation, allosteric enzyme, alternative splicing, glycolysis, magnesium, metal-binding; HET: FBP TLA DYY ADP; 1.60A {Homo sapiens} PDB: 3gqy_A* 3h6o_A* 3me3_A* 3srh_A 3srd_A 1zjh_A 4b2d_A* 4b2d_D* 3u2z_A* 3g2g_A 1t5a_A* 3bjt_A 4g1n_A* 3bjf_A* 3srf_C 1f3x_A 3n25_A 1f3w_A 1a49_A* 1a5u_A* ... Back     alignment and structure
>3khd_A Pyruvate kinase; malaria, structural genomics, structural GE consortium, SGC, transferase; 2.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>3gg8_A Pyruvate kinase; malaria, genomics, proteomics, glycolysis, magnesium, transferase, structural genomics, STRU genomics consortium, SGC; 2.21A {Toxoplasma gondii} PDB: 3eoe_A Back     alignment and structure
>1a3w_A Pyruvate kinase; allosteric regulation, tranferase, transfer; HET: FBP; 3.00A {Saccharomyces cerevisiae} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1a3x_A Back     alignment and structure
>3t05_A Pyruvate kinase, PK; tetramer, glycolysis, transferase; 3.05A {Staphylococcus aureus subsp} PDB: 3t07_A* 3t0t_A* Back     alignment and structure
>2e28_A Pyruvate kinase, PK; allosteric, transferase; 2.40A {Geobacillus stearothermophilus} Back     alignment and structure
>1e0t_A Pyruvate kinase, PK; phosphotransferase, glycolysis, allostery; 1.8A {Escherichia coli} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1pky_A 1e0u_A Back     alignment and structure
>3qtg_A Pyruvate kinase, PK; TIM barrel, glycolysis, transferase; 2.20A {Pyrobaculum aerophilum} Back     alignment and structure
>1vp8_A Hypothetical protein AF0103; putative pyruvate kinase, structural genomics, joint center structural genomics, JCSG; HET: MSE FMN; 1.30A {Archaeoglobus fulgidus} SCOP: c.49.1.2 Back     alignment and structure
>1t57_A Conserved protein MTH1675; structural genomics, FMN; HET: FMN; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.49.1.2 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3pfn_A NAD kinase; structural genomics consortium, SNP, SGC, transferase; 2.70A {Homo sapiens} Back     alignment and structure
>2xhz_A KDSD, YRBH, arabinose 5-phosphate isomerase; lipopolysaccharide biogenesis; 2.60A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 84
d1pkla3141 c.49.1.1 (A:358-498) Pyruvate kinase, C-terminal d 1e-16
d1a3xa3134 c.49.1.1 (A:367-500) Pyruvate kinase, C-terminal d 1e-13
d2vgba3134 c.49.1.1 (A:440-573) Pyruvate kinase, C-terminal d 5e-12
d2g50a3135 c.49.1.1 (A:396-530) Pyruvate kinase, C-terminal d 9e-12
d1e0ta3117 c.49.1.1 (A:354-470) Pyruvate kinase, C-terminal d 5e-09
>d1pkla3 c.49.1.1 (A:358-498) Pyruvate kinase, C-terminal domain {Leishmania mexicana [TaxId: 5665]} Length = 141 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Pyruvate kinase C-terminal domain-like
superfamily: PK C-terminal domain-like
family: Pyruvate kinase, C-terminal domain
domain: Pyruvate kinase, C-terminal domain
species: Leishmania mexicana [TaxId: 5665]

 Score = 67.3 bits (164), Expect = 1e-16
 Identities = 30/78 (38%), Positives = 44/78 (56%)

Query: 6  NHNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKYRPTMP 65
          N  +FF  +      PMS  E++ SSAV S  + KA A++  +++GR+ARL+AKYRP  P
Sbjct: 1  NEYVFFNSIKKLQHIPMSADEAVCSSAVNSVYETKAKAMVVLSNTGRSARLVAKYRPNCP 60

Query: 66 VLSVVIPQLKTNQLRWTF 83
          ++ V        QL  T 
Sbjct: 61 IVCVTTRLQTCRQLNITQ 78
>d1a3xa3 c.49.1.1 (A:367-500) Pyruvate kinase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 134 Back     information, alignment and structure
>d2g50a3 c.49.1.1 (A:396-530) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 135 Back     information, alignment and structure
>d1e0ta3 c.49.1.1 (A:354-470) Pyruvate kinase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
d1pkla3141 Pyruvate kinase, C-terminal domain {Leishmania mex 99.92
d2vgba3134 Pyruvate kinase, C-terminal domain {Human (Homo sa 99.9
d1a3xa3134 Pyruvate kinase, C-terminal domain {Baker's yeast 99.89
d2g50a3135 Pyruvate kinase, C-terminal domain {Rabbit (Orycto 99.89
d1e0ta3117 Pyruvate kinase, C-terminal domain {Escherichia co 99.88
d1vp8a_ 190 Hypothetical protein AF0103 {Archaeoglobus fulgidu 96.26
d1t57a_ 186 Hypothetical protein MTH1675 {Methanobacterium the 96.04
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 85.11
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 82.18
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 80.94
>d1pkla3 c.49.1.1 (A:358-498) Pyruvate kinase, C-terminal domain {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Pyruvate kinase C-terminal domain-like
superfamily: PK C-terminal domain-like
family: Pyruvate kinase, C-terminal domain
domain: Pyruvate kinase, C-terminal domain
species: Leishmania mexicana [TaxId: 5665]

Probab=99.92  E-value=3.3e-25  Score=141.93  Aligned_cols=77  Identities=38%  Similarity=0.562  Sum_probs=73.5

Q ss_pred             hHHHHHHHHhhcCCCCCHHHHHHHHHHHHHHhcCCcEEEEecCCchHHHHHHhhCCCCCEEEEecChhhhccccccc
Q 039146            7 HNLFFKKVINYVGEPMSHLESITSSAVRSAIKVKASAIICFTSSGRAARLIAKYRPTMPVLSVVIPQLKTNQLRWTF   83 (84)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~ia~~a~~~a~~~~~~aIv~~T~sG~ta~~iS~~Rp~~pIia~t~~~~~~r~L~l~~   83 (84)
                      ...+|+++.+..+.|.+..|+||++|+.+|.++++++|||+|.||+||+++|||||.+||||+|++++++|+|+|.+
T Consensus         2 ~~~~f~~i~~~~~~p~s~~eaia~sAv~~A~~l~akaIvv~T~sG~tar~iSk~RP~~pI~a~t~~~~~~r~l~l~~   78 (141)
T d1pkla3           2 EYVFFNSIKKLQHIPMSADEAVCSSAVNSVYETKAKAMVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQ   78 (141)
T ss_dssp             HHHHHHHHHHHSCSSCCHHHHHHHHHHHHHHHHTCSCEEEECSSSHHHHHHHHTCCSSCEEEEESCHHHHHHGGGST
T ss_pred             hHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHHcCCCEEEEECCCcHHHHHHHhhcCCCCeeeecCCHHHHHHhcccC
Confidence            45678999999999999999999999999999999999999999999999999999999999999999999999975
>d1a3xa3 c.49.1.1 (A:367-500) Pyruvate kinase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g50a3 c.49.1.1 (A:396-530) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1e0ta3 c.49.1.1 (A:354-470) Pyruvate kinase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vp8a_ c.49.1.2 (A:) Hypothetical protein AF0103 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t57a_ c.49.1.2 (A:) Hypothetical protein MTH1675 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure