Citrus Sinensis ID: 039154

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MAMVDEPLYPIAVLTDELKNDDIQLRLNSIRRLSTIARALGEERTPKELIPFLSANNDDDDEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCMRDKAVESLCRIGSQMRESDLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVRRSAASNLRKFAATVEPAHLKTDIMSIFEDLT
cccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcc
****DEPLYPIAVLTDELKNDDIQLRLNSIRRLSTIARALGEERTPKELIPFLSANNDDDDEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCMRDKAVESLCRIGSQMRESDLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVRRSAASNLRKFAATVEPAHLKTDIMSIFEDLT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMVDEPLYPIAVLTDELKNDDIQLRLNSIRRLSTIARALGEERTPKELIPFLSANNDDDDEVLLAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCMRDKAVESLCRIGSQMRESDLVDWFIPLVKRLAAGEWFTARVSACGLFHIAYPSAPDILKTELRSIYTQLCQDDMPMVRRSAASNLRKFAATVEPAHLKTDIMSIFEDLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform The A subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. Involved during developmental process such as seedling and floral developments. Seems to act as a negative regulator of PP2A catalytic activity.probableQ38950

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B3U, chain A
Confidence level:very confident
Coverage over the Query: 4-210
View the alignment between query and template
View the model in PyMOL