Citrus Sinensis ID: 039165

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950------
MVSGNLFHCRKHSWPPEEYVGRATLQLLDFDSAAPPEQAWRRRLNSHANILKEFSVTFMEAIKMVRLGIRLWSYVREEASHGRKAPIDPFTRISCKPSASQGVPLGGMGSGSISRGFRGEFRQWQIVPGTCEPSPVMANQFSIFISRDGGNKHYASVLAPGQHEGLGKAGDQGIDSWGWNLSGQHSTYHALFPRAWTIYDGEPDPELKISCRQISPFIPHNYRDSSLPTAVFVYTLVNTGKDRAKVSLLFTWANSIGGISHLSGDHVNEPFLGDDGVSGVLLHHKTARGNPPVTFAVAACETQNVNVTVLPCFGLSEGSCVTAKGMWGTMVQDGQFDRENFKSGPSMPSSPGEALCAAVSASAWVEPHGKCTVAFALAWSSPKVKFLKGSSYHRRYTKFYGTSEGVAQDLVHDALMNYKRWEEDIEKWQNPILRDDRLPEWYKFTLFNELYFLVAGGTVWIDSRLPAPDKRNHRNGEKTDVKGTEAEVNLSDGALVKYTTTSDYYSEDESVVNHEGSNSYSQHHPITLLNEENDSDDGGRFLYLEGVEYVMWCTYDVHFYASFALLELFPKIELNIQRDFAKAVLSEDGRKVKFLAEGNTGIRKLRGAVPHDLGTHDPWNEMNAYNIHDTSQWKDLNPKFVLQVYRDFAATGDMSFGVDVWPAVRAAMEYMEQFDRDGDCLIENDGFPDQTYDTWTVHGVSAYCGCLWLAALQAAAAMALQLGDKPFAEYCKGKFLKAKSVFEEKLWNGSYFNYDSGSSSNSKSIQTDQLAGQWYTASSGLPSLFDEAQIKSTLQKIFDFNVMKVKGGRMGAVNGMHPNGKVDETCMQSREIWTGVTYGVAATMILAGMEKEAFTTAEGIFTAGWSEEGYGYWFQTPEAWTMDGHFRSLIYMRPLSIWGMQWALSMPKTVLQAPEINIMDRISISPSAAAISHEFGVRKITNKAKCFGAAVFHCSC
cccccccccccccccccccccccccHHccccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccCECcccccEEEEEECccccccccccccccEEEEEcccccEEEEEEccccccccccccccccccccccccccccEEEEECccCEEEEEccccccccEEEEEEECcccccccccccccEEEEEEEEEEcccccEEEEEEEEEEccccccccccccccccccccccccCEEEEccccccccccCEEEEEEEEcccCEEEEEcccccccccccccccccHHcccccccccccccccccccccccccEEEEEEEEEEEccccCEEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHcccccccccccHHHHHHHHcEEEEEEcccEEEccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccEEEEccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccccCEEEcccccccHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccCEccccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEccccccccccEEEEcc
*********RKHSWPPEEYVGRATLQLLDFDSAAPPEQAWRRRLNSHANILKEFSVTFMEAIKMVRLGIRLWSYVREEASHGRKAPIDPFTRISCKPSASQGVPLGGMGSGSISRGFRGEFRQWQIVPGTCEPSPVMANQFSIFISRDGGNKHYASVLAPGQHEGLGKAGDQGIDSWGWNLSGQHSTYHALFPRAWTIYDGEPDPELKISCRQISPFIPHNYRDSSLPTAVFVYTLVNTGKDRAKVSLLFTWANSIGGISHLSGDHVNEPFLGDDGVSGVLLHHKTARGNPPVTFAVAACETQNVNVTVLPCFGLSEGSCVTAKGMWGTMVQDGQFDRENF*************LCAAVSASAWVEPHGKCTVAFALAWSSPKVKFLKGSSYHRRYTKFYGTSEGVAQDLVHDALMNYKRWEEDIEKWQNPILRDDRLPEWYKFTLFNELYFLVAGGTVWIDSRLPAPDKRNHRNGEKTDVKGTEAEVNLSDGALVKYTTTSDYYSEDESVVNHEGSNSYSQHHPITLLNEENDSDDGGRFLYLEGVEYVMWCTYDVHFYASFALLELFPKIELNIQRDFAKAVLSEDGRKVKFLAEGNTGIRKLRGAVPHDLGTHDPWNEMNAYNIHDTSQWKDLNPKFVLQVYRDFAATGDMSFGVDVWPAVRAAMEYMEQFDRDGDCLIENDGFPDQTYDTWTVHGVSAYCGCLWLAALQAAAAMALQLGDKPFAEYCKGKFLKAKSVFEEKLWNGSYFNYDSGSSSNSKSIQTDQLAGQWYTASSGLPSLFDEAQIKSTLQKIFDFNVMKVKGGRMGAVNGMHPNGKVDETCMQSREIWTGVTYGVAATMILAGMEKEAFTTAEGIFTAGWSEEGYGYWFQTPEAWTMDGHFRSLIYMRPLSIWGMQWALSMPKTVLQAPEINIMDRISISPSAAAISHEFGVRKITNKAKCFGAAVFHCSC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSGNLFHCRKHSWPPEEYVGRATLQLLDFDSAAPPEQAWRRRLNSHANILKEFSVTFMEAIKMVRLGIRLWSYVREEASHGRKAPIDPFTRISCKPSASQGVPLGGMGSGSISRGFRGEFRQWQIVPGTCEPSPVMANQFSIFISRDGGNKHYASVLAPGQHEGLGKAGDQGIDSWGWNLSGQHSTYHALFPRAWTIYDGEPDPELKISCRQISPFIPHNYRDSSLPTAVFVYTLVNTGKDRAKVSLLFTWANSIGGISHLSGDHVNEPFLGDDGVSGVLLHHKTARGNPPVTFAVAACETQNVNVTVLPCFGLSEGSCVTAKGMWGTMVQDGQFDRENFKSGPSMPSSPGEALCAAVSASAWVEPHGKCTVAFALAWSSPKVKFLKGSSYHRRYTKFYGTSEGVAQDLVHDALMNYKRWEEDIEKWQNPILRDDRLPEWYKFTLFNELYFLVAGGTVWIDSRLPAPDKRNHRNGEKTDVKGTEAEVNLSDGALVKYTTTSDYYSEDESVVNHEGSNSYSQHHPITLLNEENDSDDGGRFLYLEGVEYVMWCTYDVHFYASFALLELFPKIELNIQRDFAKAVLSEDGRKVKFLAEGNTGIRKLRGAVPHDLGTHDPWNEMNAYNIHDTSQWKDLNPKFVLQVYRDFAATGDMSFGVDVWPAVRAAMEYMEQFDRDGDCLIENDGFPDQTYDTWTVHGVSAYCGCLWLAALQAAAAMALQLGDKPFAEYCKGKFLKAKSVFEEKLWNGSYFNYDSGSSSNSKSIQTDQLAGQWYTASSGLPSLFDEAQIKSTLQKIFDFNVMKVKGGRMGAVNGMHPNGKVDETCMQSREIWTGVTYGVAATMILAGMEKEAFTTAEGIFTAGWSEEGYGYWFQTPEAWTMDGHFRSLIYMRPLSIWGMQWALSMPKTVLQAPEINIMDRISISPSAAAISHEFGVRKITNKAKCFGAAVFHCSC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Non-lysosomal glucosylceramidase Non-lysosomal glucosylceramidase that catalyzes the conversion of glucosylceramide to free glucose and ceramide. Involved in sphingomyelin generation and prevention of glycolipid accumulation. May also catalyze the hydrolysis of bile acid 3-O-glucosides, however, the relevance of such activity is unclear in vivo.probableQ69ZF3
Non-lysosomal glucosylceramidase Non-lysosomal glucosylceramidase that catalyzes the conversion of glucosylceramide to free glucose and ceramide. Involved in sphingomyelin generation and prevention of glycolipid accumulation. May also catalyze the hydrolysis of bile acid 3-O-glucosides, however, the relevance of such activity is unclear in vivo.probableQ9HCG7
Non-lysosomal glucosylceramidase Non-lysosomal glucosylceramidase that catalyzes the conversion of glucosylceramide to free glucose and ceramide. Involved in sphingomyelin generation and prevention of glycolipid accumulation. May also catalyze the hydrolysis of bile acid 3-O-glucosides, however, the relevance of such activity is unclear in vivo.probableQ5M868

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.2.-.-Glycosylases.probable
3.2.1.-Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.probable
3.2.1.45Glucosylceramidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QDE, chain A
Confidence level:confident
Coverage over the Query: 187-463,483-484,508-588,607-883
View the alignment between query and template
View the model in PyMOL
Template: 1V7W, chain A
Confidence level:confident
Coverage over the Query: 556-604,625-861
View the alignment between query and template
View the model in PyMOL
Template: 2OKX, chain A
Confidence level:confident
Coverage over the Query: 556-588,607-801,818-906
View the alignment between query and template
View the model in PyMOL