Citrus Sinensis ID: 039203


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MSYRREHRASKGALFDEYDGLEEGGLKASSSYSSGIDEHDNDKAIDGLKERAVFLKRLTGDIHEEVESHNRLLDRMGNSMDASRGIMSGTMDRFKMVFEKKSNRRICTLVGSFVVSFFVLYYLIR
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHc
***********************************************LKERAVFLKRLTGDIHEEVESHNRLLDRMGNS***********MDRFKMVFEKKSNRRICTLVGSFVVSFFVLYYLIR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYRREHRASKGALFDEYDGLEEGGLKASSSYSSGIDEHDNDKAIDGLKERAVFLKRLTGDIHEEVESHNRLLDRMGNSMDASRGIMSGTMDRFKMVFEKKSNRRICTLVGSFVVSFFVLYYLIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bet1-like SNARE 1-2 Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE associated with ER-derived vesicles.probableQ94CG2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SFC, chain D
Confidence level:confident
Coverage over the Query: 24-99
View the alignment between query and template
View the model in PyMOL