Citrus Sinensis ID: 039296

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MGKDLPGIATGNWGCGAFGGDPELKAIIQWLAASQASRPFVLYYTFGIDALQNLDQITQWILSHEWTVRDLWNMMVEYSSQRLNGRTNLGFFAWLLPSLTSHNFISPASDFNYPAK
cccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHccccccccccccccccccc
*****PGIATGNWGCGAFGGDPELKAIIQWLAASQASRPFVLYYTFGIDALQNLDQITQWILSHEWTVRDLWNMMVEYSSQRLNGRTNLGFFAWLLPSLTS***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKDLPGIATGNWGCGAFGGDPELKAIIQWLAASQASRPFVLYYTFGIDALQNLDQITQWILSHEWTVRDLWNMMVEYSSQRLNGRTNLGFFAWLLPSLTSHNFISPASDFNYPAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Poly(ADP-ribose) glycohydrolase 1 Poly(ADP-ribose) synthesized after DNA damage is only present transiently and is rapidly degraded by poly(ADP-ribose) glycohydrolase (By similarity). Involved in establishing period length of the circadian oscillator. May regulate post-translational poly(ADP-ribosyl)ation of an oscillator component.probableQ9SKB3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UEK, chain A
Confidence level:very confident
Coverage over the Query: 5-101
View the alignment between query and template
View the model in PyMOL