Citrus Sinensis ID: 039386


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580--
MGPRICMNPKCRTANTHEWKKGWLLRSGVCADLCYDCGSAYENFIFCNTFHLEEPGWRECNFCSKRLHCGCRASNSFLELLDYGGVGCRSCAMSPRLHLIQRDEIPNGFGALTKKDSDDTQTPMLENRVVGDGTAEGKLTQLCRIMEANEPSFLAPFQRGDTIVSLGQEKREELRLPFVEVGTGFSSPTKLSSRSSKFTKPDGSRSMLDVRDMPESLAQRSSSMSLGVPAGCSNFVPPFSNGAADGREPCKAHPSFQQGQRSRPILPKPSKTGLTISSETKKSTASQLRIARPPAEGRGKNHLLPRYWPRITDQELQQLSGDLNSTIVPLFEKILSASDAGRIGRLVLPKACAEAYFPHISQSEGVPLRVQDVKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQSMQLRAGDTSMIHSILTRDDKITFSRIDPGGKLVMGFRKAPIPGDMQDAQTSAITNGCPGESFLSGVTENLPTVSGYSGHFQMLKGSKDPHIDALSEHLSLAEGGNGWHKSENHGQKTNEDSPQKSLLGMEKKRTRNIGSKSKRLLMHSEEAMELRLTWEEAQDLLRPSPSARTKHCHY
cccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccCCcccccccccccccccccccHHcccccCEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHHHccccccccEEccEEEEcccccccccccEEEcHHHHHHHcccccccccccEEEEEccccEEEEEEEECcccccCEEEEcccHHHHHHcccccccEEEEEcccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccc
**PRICMNPKCRTANTHEWKKGWLLRSGVCADLCYDCGSAYENFIFCNTFHLEEPGWRECNFCSKRLHCGCRASNSFLELLDYGGVGCRSCAMSPR********************************************Q**********SFLA*FQRGDTIVSL********RLPFVEV**************************************************************************************************************************LPRYWPRITDQELQQLSGDLNSTIVPLFEKILSASDAGRIGRLVLPKACAEAYFPHISQSEGVPLRVQDVKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQSMQLRAGDTSMIHSILTRDDKITFSRIDPGGKLVMGFRKA******************************************************************************************************KRLLMHSEEAMELRLTWEEAQDL**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPRICMNPKCRTANTHEWKKGWLLRSGVCADLCYDCGSAYENFIFCNTFHLEEPGWRECNFCSKRLHCGCRASNSFLELLDYGGVGCRSCAMSPRLHLIQRDEIPNGFGALTKKDSDDTQTPMLENRVVGDGTAEGKLTQLCRIMEANEPSFLAPFQRGDTIVSLGQEKREELRLPFVEVGTGFSSPTKLSSRSSKFTKPDGSRSMLDVRDMPESLAQRSSSMSLGVPAGCSNFVPPFSNGAADGREPCKAHPSFQQGQRSRPILPKPSKTGLTISSETKKSTASQLRIARPPAEGRGKNHLLPRYWPRITDQELQQLSGDLNSTIVPLFEKILSASDAGRIGRLVLPKACAEAYFPHISQSEGVPLRVQDVKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQSMQLRAGDTSMIHSILTRDDKITFSRIDPGGKLVMGFRKAPIPGDMQDAQTSAITNGCPGESFLSGVTENLPTVSGYSGHFQMLKGSKDPHIDALSEHLSLAEGGNGWHKSENHGQKTNEDSPQKSLLGMEKKRTRNIGSKSKRLLMHSEEAMELRLTWEEAQDLLRPSPSARTKHCHY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WID, chain A
Confidence level:very confident
Coverage over the Query: 325-412,425-450
View the alignment between query and template
View the model in PyMOL
Template: 3DFX, chain A
Confidence level:probable
Coverage over the Query: 3-45
View the alignment between query and template
View the model in PyMOL
Template: 4HC9, chain A
Confidence level:probable
Coverage over the Query: 4-94
View the alignment between query and template
View the model in PyMOL