Citrus Sinensis ID: 039411

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSHYEFFPGRPRWPPSNSHLTYAFLPGTPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLKISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWAVGARPGAFDLETVALHEIGHLLGLDHSLVEGAIMYAYIDPGATKGLHTDDVQGIRALYNNV
cHHHHHHccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccEEEEcccccccccccccEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEEcccccccEEEEEEccccccccccccccccEEEEccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccEEEEccccccccccHHHHHHHHHHHccc
cHHHHHHccccEcccccHHHHHHHcccccccccccccccEEcccccccccccccEEEEEEEEEccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEcccccccEEEEEEcccccccccccccccccEEEcccccccccccccccccccccccccEHHHHHHHHHHHHHcEEccccccccccccccccccccccHHHHHHHHHHHccc
mktyqlnyhlnstgvldgntvammtrprcgvadivngttrmrsgmkshqhganhfhtvshyeffpgrprwppsnshltyaflpgtpaEAINAVGRAFQTWAAIShfkfsqtqdytnanlkisfqrgwhgdsspfdgrggtiahaapprggifdydadeqwavgarpgafdlETVALHEIGHLLGLDHSLVEGAIMYAyidpgatkglhtddVQGIRALYNNV
mktyqlnyhlnstgvLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSHYEFFPGRPRWPPSNSHLTYAFLPGTPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLKISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWAVGARPGAFDLETVALHEIGHLLGLDHSLVEGAIMYAYIDPGATKGLHTDDVQGIRALYNNV
MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSHYEFFPGRPRWPPSNSHLTYAFLPGTPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLKISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWAVGARPGAFDLETVALHEIGHLLGLDHSLVEGAIMYAYIDPGATKGLHTDDVQGIRALYNNV
****QLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTT************ANHFHTVSHYEFFPGRPRWPPSNSHLTYAFLPGTPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLKISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWAVGARPGAFDLETVALHEIGHLLGLDHSLVEGAIMYAYIDPGATKGLHTDDVQGIRALY***
MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMR*********ANHFHTVSHYEFFPGRPRWPPSNSHLTYAFLPGTPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLKISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWAVGARPGAFDLETVALHEIGHLLGLDHSLVEGAIMYAYIDPGATKGLHTDDVQGIRALYNNV
MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMR*********ANHFHTVSHYEFFPGRPRWPPSNSHLTYAFLPGTPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLKISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWAVGARPGAFDLETVALHEIGHLLGLDHSLVEGAIMYAYIDPGATKGLHTDDVQGIRALYNNV
MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRS********ANHFHTVSHYEFFPGRPRWPPSNSHLTYAFLPGTPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLKISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWAVGARPGAFDLETVALHEIGHLLGLDHSLVEGAIMYAYIDPGATKGLHTDDVQGIRALYNNV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSHYEFFPGRPRWPPSNSHLTYAFLPGTPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLKISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWAVGARPGAFDLETVALHEIGHLLGLDHSLVEGAIMYAYIDPGATKGLHTDDVQGIRALYNNV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query222 2.2.26 [Sep-21-2011]
P29136305 Metalloendoproteinase 1 O no no 0.936 0.681 0.447 4e-43
P21692 469 Interstitial collagenase yes no 0.851 0.402 0.378 6e-29
P79287 483 Matrix metalloproteinase- no no 0.855 0.393 0.381 2e-28
Q6Y4Q5 478 Stromelysin-1 OS=Canis fa yes no 0.855 0.397 0.371 2e-28
P13943 468 Interstitial collagenase yes no 0.851 0.403 0.370 6e-28
O60882 483 Matrix metalloproteinase- yes no 0.855 0.393 0.372 8e-28
P07152 476 Stromelysin-2 OS=Rattus n yes no 0.815 0.380 0.363 9e-28
O18767 481 Matrix metalloproteinase- no no 0.851 0.392 0.379 1e-27
P91953 591 50 kDa hatching enzyme OS N/A no 0.828 0.311 0.36 1e-27
Q9XSZ5 469 Interstitial collagenase no no 0.851 0.402 0.374 2e-27
>sp|P29136|MEP1_SOYBN Metalloendoproteinase 1 OS=Glycine max PE=1 SV=2 Back     alignment and function desciption
 Score =  174 bits (441), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 102/228 (44%), Positives = 122/228 (53%), Gaps = 20/228 (8%)

Query: 1   MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSH 60
           +KTYQ NY+LN TG  D NT+  +  PRCGV DI+  T +  S           F  +S 
Sbjct: 85  IKTYQKNYNLNVTGKFDINTLKQIMTPRCGVPDIIINTNKTTS-----------FGMISD 133

Query: 61  YEFFPGRPRWPPSNSHLTYAFLPGTPAEAI--NAVGRAFQTWAAISHFKFSQTQDYTNAN 118
           Y FF   PRW    + LTYAF P    +    +A+ RAF  W  + +  F +T  Y  AN
Sbjct: 134 YTFFKDMPRWQAGTTQLTYAFSPEPRLDDTFKSAIARAFSKWTPVVNIAFQETTSYETAN 193

Query: 119 LKISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWA----VGARP--GAFDLE 172
           +KI F    HGD  PFDG GG + HA  P  G   +DADE W     V   P   AFDLE
Sbjct: 194 IKILFASKNHGDPYPFDGPGGILGHAFAPTDGRCHFDADEYWVASGDVTKSPVTSAFDLE 253

Query: 173 TVALHEIGHLLGLDHSLVEGAIMYAYIDPGATK-GLHTDDVQGIRALY 219
           +VA+HEIGHLLGL HS    AIMY  I P   K  L  DD+ GIR LY
Sbjct: 254 SVAVHEIGHLLGLGHSSDLRAIMYPSIPPRTRKVNLAQDDIDGIRKLY 301
Specificity similar to that of mammalian matrix metalloproteases. May act against cell wall components.
Glycine max (taxid: 3847)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|P21692|MMP1_PIG Interstitial collagenase OS=Sus scrofa GN=MMP1 PE=1 SV=2 Back     alignment and function description
>sp|P79287|MMP20_PIG Matrix metalloproteinase-20 OS=Sus scrofa GN=MMP20 PE=2 SV=1 Back     alignment and function description
>sp|Q6Y4Q5|MMP3_CANFA Stromelysin-1 OS=Canis familiaris GN=MMP3 PE=2 SV=1 Back     alignment and function description
>sp|P13943|MMP1_RABIT Interstitial collagenase OS=Oryctolagus cuniculus GN=MMP1 PE=2 SV=1 Back     alignment and function description
>sp|O60882|MMP20_HUMAN Matrix metalloproteinase-20 OS=Homo sapiens GN=MMP20 PE=1 SV=3 Back     alignment and function description
>sp|P07152|MMP10_RAT Stromelysin-2 OS=Rattus norvegicus GN=Mmp10 PE=2 SV=1 Back     alignment and function description
>sp|O18767|MMP20_BOVIN Matrix metalloproteinase-20 OS=Bos taurus GN=MMP20 PE=1 SV=1 Back     alignment and function description
>sp|P91953|HE_HEMPU 50 kDa hatching enzyme OS=Hemicentrotus pulcherrimus PE=1 SV=1 Back     alignment and function description
>sp|Q9XSZ5|MMP1_HORSE Interstitial collagenase OS=Equus caballus GN=MMP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
255552736311 Metalloendoproteinase 1 precursor, putat 0.990 0.707 0.687 2e-84
147790365319 hypothetical protein VITISV_011608 [Viti 0.990 0.689 0.645 3e-80
359485078319 PREDICTED: metalloendoproteinase 1-like 0.990 0.689 0.636 3e-78
225452578321 PREDICTED: metalloendoproteinase 1-like 0.990 0.685 0.651 2e-76
147807821 437 hypothetical protein VITISV_030258 [Viti 0.990 0.503 0.638 1e-74
255552738321 Matrix metalloproteinase, putative [Rici 1.0 0.691 0.614 9e-74
449449409313 PREDICTED: metalloendoproteinase 1-like 0.986 0.699 0.603 4e-73
225452580319 PREDICTED: metalloendoproteinase 1 [Viti 0.990 0.689 0.620 2e-72
225452582315 PREDICTED: metalloendoproteinase 1-like 0.990 0.698 0.627 5e-72
449449419319 PREDICTED: metalloendoproteinase 1-like 1.0 0.695 0.595 6e-72
>gi|255552736|ref|XP_002517411.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] gi|223543422|gb|EEF44953.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 152/221 (68%), Positives = 172/221 (77%), Gaps = 1/221 (0%)

Query: 1   MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKS-HQHGANHFHTVS 59
           +KTYQ NYHLN TG LD  TV  M  PRCGVADI+NGTTRM+S  K+ H H +  FHTVS
Sbjct: 90  LKTYQFNYHLNVTGFLDSETVTKMMMPRCGVADIINGTTRMQSSNKNPHHHSSTSFHTVS 149

Query: 60  HYEFFPGRPRWPPSNSHLTYAFLPGTPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANL 119
           HYEFFPG PRWP S  HLTY FLPGTP +A+  V +AFQTWAA +HF+F++ QDY  A++
Sbjct: 150 HYEFFPGNPRWPASKYHLTYGFLPGTPNQAMEPVAKAFQTWAANTHFRFTRVQDYRAADI 209

Query: 120 KISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWAVGARPGAFDLETVALHEI 179
            I F RG HGD SPFDGRGGT+AHA  P+ G F YD DE WAVGA  GAFD+ETVALHEI
Sbjct: 210 TIGFHRGDHGDGSPFDGRGGTLAHAFAPQDGRFHYDGDEHWAVGATQGAFDVETVALHEI 269

Query: 180 GHLLGLDHSLVEGAIMYAYIDPGATKGLHTDDVQGIRALYN 220
           GHLLGL HS VEGAIM+  I  GATKGLH+DD+QGIRALYN
Sbjct: 270 GHLLGLGHSSVEGAIMHPSIQSGATKGLHSDDIQGIRALYN 310

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147790365|emb|CAN59960.1| hypothetical protein VITISV_011608 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485078|ref|XP_003633209.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225452578|ref|XP_002280805.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147807821|emb|CAN73130.1| hypothetical protein VITISV_030258 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255552738|ref|XP_002517412.1| Matrix metalloproteinase, putative [Ricinus communis] gi|223543423|gb|EEF44954.1| Matrix metalloproteinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449449409|ref|XP_004142457.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] gi|449527361|ref|XP_004170680.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225452580|ref|XP_002280833.1| PREDICTED: metalloendoproteinase 1 [Vitis vinifera] gi|147807820|emb|CAN73129.1| hypothetical protein VITISV_030257 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225452582|ref|XP_002275556.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449449419|ref|XP_004142462.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] gi|449492747|ref|XP_004159088.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
TAIR|locus:2032467384 AT1G24140 [Arabidopsis thalian 0.986 0.570 0.452 2.6e-47
TAIR|locus:2020548378 MMP "matrix metalloproteinase" 0.986 0.579 0.443 6.2e-46
TAIR|locus:2025891360 AT1G59970 [Arabidopsis thalian 0.950 0.586 0.415 2.8e-41
TAIR|locus:2130928364 AT4G16640 [Arabidopsis thalian 0.905 0.552 0.427 2.1e-36
UNIPROTKB|Q5ZMQ8263 MMP7 "Uncharacterized protein" 0.702 0.593 0.418 9e-34
UNIPROTKB|F1N995 478 MMP10 "Uncharacterized protein 0.725 0.336 0.410 1.3e-33
TAIR|locus:2055605342 AT2G45040 [Arabidopsis thalian 0.914 0.593 0.407 1.5e-33
UNIPROTKB|E1C9E0 472 MMP10 "Uncharacterized protein 0.716 0.336 0.409 5.9e-33
UNIPROTKB|P21692 469 MMP1 "Interstitial collagenase 0.702 0.332 0.423 6.7e-33
UNIPROTKB|P79287 483 MMP20 "Matrix metalloproteinas 0.707 0.325 0.421 8.6e-32
TAIR|locus:2032467 AT1G24140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 495 (179.3 bits), Expect = 2.6e-47, P = 2.6e-47
 Identities = 106/234 (45%), Positives = 136/234 (58%)

Query:     1 MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHG----ANHFH 56
             ++ YQ N+ LN TGVLD  T+  +  PRCG  D+VNGT+ M SG K+ +         FH
Sbjct:    95 VEMYQRNFQLNVTGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRKTFEVSFAGRGQRFH 154

Query:    57 TVSHYEFFPGRPRWPPSNSHLTYAFLPGTP-AEAINAV-GRAFQTWAAISHFKFSQTQDY 114
              V HY FFPG PRWP +   LTYAF P     E + +V  RAF  W  ++   F++ + +
Sbjct:   155 AVKHYSFFPGEPRWPRNRRDLTYAFDPRNALTEEVKSVFSRAFTRWEEVTPLTFTRVERF 214

Query:   115 TNANLKISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWAVGARPG------- 167
             + +++ I F  G HGD  PFDG   T+AHA  P  G F  D +E W V    G       
Sbjct:   215 STSDISIGFYSGEHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVS 274

Query:   168 -AFDLETVALHEIGHLLGLDHSLVEGAIMYAYIDPGATK-GLHTDDVQGIRALY 219
              A DLE+VA+HEIGHLLGL HS VEG+IMY  I  G  K  L TDDV+G++ LY
Sbjct:   275 EAVDLESVAVHEIGHLLGLGHSSVEGSIMYPTIRTGRRKVDLTTDDVEGVQYLY 328
GO:0004222 "metalloendopeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0008237 "metallopeptidase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0031012 "extracellular matrix" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
GO:0009693 "ethylene biosynthetic process" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
TAIR|locus:2020548 MMP "matrix metalloproteinase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025891 AT1G59970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130928 AT4G16640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMQ8 MMP7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N995 MMP10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TAIR|locus:2055605 AT2G45040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C9E0 MMP10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P21692 MMP1 "Interstitial collagenase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P79287 MMP20 "Matrix metalloproteinase-20" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.240.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00020814001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (820 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
cd04278157 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, 2e-54
pfam00413159 pfam00413, Peptidase_M10, Matrixin 4e-54
cd04279156 cd04279, ZnMc_MMP_like_1, Zinc-dependent metallopr 1e-15
smart00235139 smart00235, ZnMc, Zinc-dependent metalloprotease 2e-13
cd04327198 cd04327, ZnMc_MMP_like_3, Zinc-dependent metallopr 2e-06
cd04277186 cd04277, ZnMc_serralysin_like, Zinc-dependent meta 3e-06
cd04268165 cd04268, ZnMc_MMP_like, Zinc-dependent metalloprot 3e-05
cd11375173 cd11375, Peptidase_M54, Peptidase family M54, also 0.002
>gnl|CDD|239805 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information 
 Score =  170 bits (434), Expect = 2e-54
 Identities = 68/158 (43%), Positives = 90/158 (56%), Gaps = 9/158 (5%)

Query: 69  RWPPSNSHLTYAFLPGTP----AEAINAVGRAFQTWAAISHFKFSQTQDYTNANLKISFQ 124
           +W  +  +LTY  L   P     +   A+ RAF+ W+ ++   F +      A+++ISF 
Sbjct: 1   KWSKT--NLTYRILNYPPDLPRDDVRRAIARAFRVWSDVTPLTFREVTSGQEADIRISFA 58

Query: 125 RGWHGDSSPFDGRGGTIAHAAPP--RGGIFDYDADEQWAVGARPGAFDLETVALHEIGHL 182
           RG HGD  PFDG GGT+AHA  P   GG   +D DEQW +G+  G  DL +VA HEIGH 
Sbjct: 59  RGNHGDGYPFDGPGGTLAHAFFPGGIGGDIHFDDDEQWTLGSDSGGTDLFSVAAHEIGHA 118

Query: 183 LGLDHSLVEGAIMYAYIDPGATKG-LHTDDVQGIRALY 219
           LGL HS    +IMY Y      K  L  DD++GI+ALY
Sbjct: 119 LGLGHSSDPDSIMYPYYQGPVPKFKLSQDDIRGIQALY 156

MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases). Length = 157
>gnl|CDD|215908 pfam00413, Peptidase_M10, Matrixin Back     alignment and domain information
>gnl|CDD|239806 cd04279, ZnMc_MMP_like_1, Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information
>gnl|CDD|214576 smart00235, ZnMc, Zinc-dependent metalloprotease Back     alignment and domain information
>gnl|CDD|239819 cd04327, ZnMc_MMP_like_3, Zinc-dependent metalloprotease; MMP_like sub-family 3 Back     alignment and domain information
>gnl|CDD|239804 cd04277, ZnMc_serralysin_like, Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>gnl|CDD|239796 cd04268, ZnMc_MMP_like, Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>gnl|CDD|213029 cd11375, Peptidase_M54, Peptidase family M54, also called archaemetzincins or archaelysins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
KOG1565 469 consensus Gelatinase A and related matrix metallop 100.0
cd04278157 ZnMc_MMP Zinc-dependent metalloprotease, matrix me 100.0
PF00413154 Peptidase_M10: Matrixin This Prosite motif covers 100.0
cd04279156 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MM 99.97
cd04268165 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_ 99.94
smart00235140 ZnMc Zinc-dependent metalloprotease. Neutral zinc 99.92
cd04277186 ZnMc_serralysin_like Zinc-dependent metalloproteas 99.91
cd04327198 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MM 99.83
cd00203167 ZnMc Zinc-dependent metalloprotease. This super-fa 99.8
cd04280180 ZnMc_astacin_like Zinc-dependent metalloprotease, 99.72
cd04276197 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MM 99.7
cd04281200 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1 99.68
PF12388211 Peptidase_M57: Dual-action HEIGH metallo-peptidase 99.68
) family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01400">PF01400191 Astacin: Astacin (Peptidase family M12A) This Pros 99.67
cd04282230 ZnMc_meprin Zinc-dependent metalloprotease, meprin 99.64
cd04283182 ZnMc_hatching_enzyme Zinc-dependent metalloproteas 99.6
KOG3714 411 consensus Meprin A metalloprotease [Posttranslatio 99.53
PF02031132 Peptidase_M7: Streptomyces extracellular neutral p 99.11
COG5549236 Predicted Zn-dependent protease [Posttranslational 99.09
cd04267192 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADA 98.15
PF13583206 Reprolysin_4: Metallo-peptidase family M12B Reprol 98.07
cd04273207 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, A 97.96
PF0147157 PG_binding_1: Putative peptidoglycan binding domai 97.92
PF05572154 Peptidase_M43: Pregnancy-associated plasma protein 97.91
PF11350203 DUF3152: Protein of unknown function (DUF3152); In 97.9
PF13574173 Reprolysin_2: Metallo-peptidase family M12B Reprol 97.69
COG1913181 Predicted Zn-dependent proteases [General function 97.6
cd04271228 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, A 97.5
PF13582124 Reprolysin_3: Metallo-peptidase family M12B Reprol 97.5
PRK13267179 archaemetzincin-like protein; Reviewed 97.45
PF13688196 Reprolysin_5: Metallo-peptidase family M12; PDB: 2 97.43
cd04269194 ZnMc_adamalysin_II_like Zinc-dependent metalloprot 97.42
cd04275225 ZnMc_pappalysin_like Zinc-dependent metalloproteas 97.37
PF07998194 Peptidase_M54: Peptidase family M54; InterPro: IPR 97.28
PF01421199 Reprolysin: Reprolysin (M12B) family zinc metallop 96.97
cd04270244 ZnMc_TACE_like Zinc-dependent metalloprotease; TAC 96.96
cd04272220 ZnMc_salivary_gland_MPs Zinc-dependent metalloprot 96.92
TIGR03296286 M6dom_TIGR03296 M6 family metalloprotease domain. 96.23
PF11150213 DUF2927: Protein of unknown function (DUF2927); In 95.73
PF10462305 Peptidase_M66: Peptidase M66; InterPro: IPR019503 95.62
PF01457 521 Peptidase_M8: Leishmanolysin This Prosite motif co 95.58
PF05548 314 Peptidase_M11: Gametolysin peptidase M11; InterPro 95.44
PTZ00337 567 surface protease GP63; Provisional 95.37
PF12044423 Metallopep: Putative peptidase family; InterPro: I 95.02
PTZ00257 622 Glycoprotein GP63 (leishmanolysin); Provisional 94.23
COG2738226 Predicted Zn-dependent protease [General function 93.77
PF04298222 Zn_peptidase_2: Putative neutral zinc metallopepti 93.28
KOG3658 764 consensus Tumor necrosis factor-alpha-converting e 93.06
COG3824136 Predicted Zn-dependent protease [General function 92.46
TIGR02869201 spore_SleB spore cortex-lytic enzyme. Members of t 91.87
COG4783 484 Putative Zn-dependent protease, contains TPR repea 91.5
KOG4525 614 consensus Jacalin-like lectin domain-containing pr 91.06
PF05547 645 Peptidase_M6: Immune inhibitor A peptidase M6; Int 91.0
PF09471264 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019 90.52
KOG3607 716 consensus Meltrins, fertilins and related Zn-depen 90.28
PF0626297 DUF1025: Possibl zinc metallo-peptidase; InterPro: 88.54
PRK10594608 murein L,D-transpeptidase; Provisional 87.95
PF04228292 Zn_peptidase: Putative neutral zinc metallopeptida 87.77
PF12725318 DUF3810: Protein of unknown function (DUF3810); In 87.69
PF13398 200 Peptidase_M50B: Peptidase M50B-like 86.56
PF01863205 DUF45: Protein of unknown function DUF45; InterPro 86.1
PF14247220 DUF4344: Domain of unknown function (DUF4344) 84.86
COG2856213 Predicted Zn peptidase [Amino acid transport and m 84.76
PF06114122 DUF955: Domain of unknown function (DUF955); Inter 84.76
COG5549236 Predicted Zn-dependent protease [Posttranslational 82.54
PF01435226 Peptidase_M48: Peptidase family M48 This is family 81.42
cd06456 422 M3A_DCP_Oligopeptidase_A Peptidase family M3 dipep 81.19
COG2989561 Uncharacterized protein conserved in bacteria [Fun 80.99
cd06457 458 M3A_MIP Peptidase M3 mitochondrial intermediate pe 80.79
PRK02870 336 heat shock protein HtpX; Provisional 80.16
>KOG1565 consensus Gelatinase A and related matrix metalloproteases [Posttranslational modification, protein turnover, chaperones; Extracellular structures] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-54  Score=391.87  Aligned_cols=193  Identities=45%  Similarity=0.789  Sum_probs=178.1

Q ss_pred             ChhhhhcCCCCCccCCCHHHHHHhcCCCCCCCCCCCCcccccCCCcccCCCCCcccccceeeeCCCCCCCCCCCceeEEE
Q 039411            1 MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSHYEFFPGRPRWPPSNSHLTYA   80 (222)
Q Consensus         1 i~~~Q~~~~L~~TG~ld~~T~~~m~~pRCg~pD~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~W~~~~~~lty~   80 (222)
                      |+.||++++|++||+||.+|+++|.+||||+||.                         +|.+++++.||+  +.+|||+
T Consensus        62 l~~~q~~~~l~~tG~lD~~Tl~~m~~prCgvpd~-------------------------~~~~~~~~~kW~--k~~lT~r  114 (469)
T KOG1565|consen   62 LKMMQDFFGLPVTGKLDNATLALMNKPRCGVPDG-------------------------RYRYFPGKPKWN--KEHLTYR  114 (469)
T ss_pred             HHhhhhhcCccccCCcchhhhhhccCCCcCCCCC-------------------------ccccCcccCccc--cccccee
Confidence            5789999999999999999999999999999991                         456677999999  9999999


Q ss_pred             ecCCC----hHHHHHHHHHHHHHHHhcccceEEEecCCCCceEEEEEeecCCCCCCCCCCCCCeeeeecCC---CCceee
Q 039411           81 FLPGT----PAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLKISFQRGWHGDSSPFDGRGGTIAHAAPP---RGGIFD  153 (222)
Q Consensus        81 ~~~~~----~~~~~~~i~~A~~~W~~~~~l~F~ev~~~~~adI~I~f~~~~~gd~~~f~g~g~~la~a~~P---~~g~i~  153 (222)
                      |.+.+    ..+++.++++||+.|+++++|+|.|+.....|||+|.|..+.|+|++||||++|+|||||+|   .+|++|
T Consensus       115 i~n~~~~l~~~~vr~~~~~Af~~Ws~vtpl~f~e~~~~~~aDi~i~F~~~~h~d~~PFDG~~g~laHAf~Pg~~~~G~~h  194 (469)
T KOG1565|consen  115 IKNYTPYLPQAEVRCAKSEAFKLWSDVTPLTFQEVKEEGEADIRISFFPGDHGDGFPFDGPGGVLAHAFFPGPGIGGDLH  194 (469)
T ss_pred             ccccCCCCCHHHHHHHHHHHHhhcccCCCCccccCCCCCCCceeeeeeccCCCCCCcccCCCCceecccCCCCCCCCccc
Confidence            99885    33899999999999999999999999986699999999999999999999999999999999   689999


Q ss_pred             ecCCCCcccCCCCCccchhHHHHHhhhhhcCCCCCCCCCCceeeeeCC-CCCCCCCHhhHHHHHHHhcC
Q 039411          154 YDADEQWAVGARPGAFDLETVALHEIGHLLGLDHSLVEGAIMYAYIDP-GATKGLHTDDVQGIRALYNN  221 (222)
Q Consensus       154 fd~~~~w~~~~~~~~~~~~~va~HEiGHaLGL~Hs~~~~siM~p~~~~-~~~~~l~~~Di~~iq~LYg~  221 (222)
                      ||++|.|+++ ...+.+++.||+|||||+|||.||.++++||||+|.+ .....|+.|||.+||.|||.
T Consensus       195 fD~dE~Wt~~-~~~g~~l~~Va~HEiGH~LGL~HS~~~~aiM~P~y~~~~~~~~L~~DDv~giq~lYG~  262 (469)
T KOG1565|consen  195 FDKDETWTYG-DSNGVDLFLVAAHEIGHALGLGHSSDPDAIMYPFYQPDSGNFDLSQDDVRGIQHLYGG  262 (469)
T ss_pred             cCcccceecc-CCccchhHHHhhhhcccccccCCCCCcccccccccccCCCCcccChhhhhhhHHHhCC
Confidence            9999999997 3457899999999999999999999999999999994 34568999999999999996

>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information
>PF00413 Peptidase_M10: Matrixin This Prosite motif covers only the active site Back     alignment and domain information
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>smart00235 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3 Back     alignment and domain information
>cd00203 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site Back     alignment and domain information
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2 Back     alignment and domain information
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily Back     alignment and domain information
>PF12388 Peptidase_M57: Dual-action HEIGH metallo-peptidase; InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57 Back     alignment and domain information
>PF01400 Astacin: Astacin (Peptidase family M12A) This Prosite motif covers only the active site Back     alignment and domain information
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily Back     alignment and domain information
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily Back     alignment and domain information
>KOG3714 consensus Meprin A metalloprotease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02031 Peptidase_M7: Streptomyces extracellular neutral proteinase (M7) family; InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup Back     alignment and domain information
>PF13583 Reprolysin_4: Metallo-peptidase family M12B Reprolysin-like Back     alignment and domain information
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup Back     alignment and domain information
>PF01471 PG_binding_1: Putative peptidoglycan binding domain; InterPro: IPR002477 This entry represents peptidoglycan binding domain (PGBD), as well as related domains that share the same structure Back     alignment and domain information
>PF05572 Peptidase_M43: Pregnancy-associated plasma protein-A; InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF11350 DUF3152: Protein of unknown function (DUF3152); InterPro: IPR022603 This entry represents Actinobacteria proteins of unknown function Back     alignment and domain information
>PF13574 Reprolysin_2: Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A Back     alignment and domain information
>COG1913 Predicted Zn-dependent proteases [General function prediction only] Back     alignment and domain information
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup Back     alignment and domain information
>PF13582 Reprolysin_3: Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C Back     alignment and domain information
>PRK13267 archaemetzincin-like protein; Reviewed Back     alignment and domain information
>PF13688 Reprolysin_5: Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B Back     alignment and domain information
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily Back     alignment and domain information
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily Back     alignment and domain information
>PF07998 Peptidase_M54: Peptidase family M54; InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF01421 Reprolysin: Reprolysin (M12B) family zinc metalloprotease This Prosite motif covers only the active site Back     alignment and domain information
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily Back     alignment and domain information
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs Back     alignment and domain information
>TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain Back     alignment and domain information
>PF11150 DUF2927: Protein of unknown function (DUF2927); InterPro: IPR021323 This family is conserved in Proteobacteria Back     alignment and domain information
>PF10462 Peptidase_M66: Peptidase M66; InterPro: IPR019503 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF01457 Peptidase_M8: Leishmanolysin This Prosite motif covers only the active site Back     alignment and domain information
>PF05548 Peptidase_M11: Gametolysin peptidase M11; InterPro: IPR008752 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PTZ00337 surface protease GP63; Provisional Back     alignment and domain information
>PF12044 Metallopep: Putative peptidase family; InterPro: IPR021917 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PTZ00257 Glycoprotein GP63 (leishmanolysin); Provisional Back     alignment and domain information
>COG2738 Predicted Zn-dependent protease [General function prediction only] Back     alignment and domain information
>PF04298 Zn_peptidase_2: Putative neutral zinc metallopeptidase; InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases Back     alignment and domain information
>KOG3658 consensus Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases [Extracellular structures] Back     alignment and domain information
>COG3824 Predicted Zn-dependent protease [General function prediction only] Back     alignment and domain information
>TIGR02869 spore_SleB spore cortex-lytic enzyme Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4525 consensus Jacalin-like lectin domain-containing protein [General function prediction only] Back     alignment and domain information
>PF05547 Peptidase_M6: Immune inhibitor A peptidase M6; InterPro: IPR008757 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF09471 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3607 consensus Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06262 DUF1025: Possibl zinc metallo-peptidase; InterPro: IPR010428 This is a family of bacterial protein with undetermined function Back     alignment and domain information
>PRK10594 murein L,D-transpeptidase; Provisional Back     alignment and domain information
>PF04228 Zn_peptidase: Putative neutral zinc metallopeptidase; InterPro: IPR007343 Members of this family of bacterial proteins are described as hypothetical proteins or zinc metallopeptidases Back     alignment and domain information
>PF12725 DUF3810: Protein of unknown function (DUF3810); InterPro: IPR024294 This family of bacterial proteins is functionally uncharacterised Back     alignment and domain information
>PF13398 Peptidase_M50B: Peptidase M50B-like Back     alignment and domain information
>PF01863 DUF45: Protein of unknown function DUF45; InterPro: IPR002725 Members of this family are found in some archaebacteria, as well as Helicobacter pylori Back     alignment and domain information
>PF14247 DUF4344: Domain of unknown function (DUF4344) Back     alignment and domain information
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF06114 DUF955: Domain of unknown function (DUF955); InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function Back     alignment and domain information
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01435 Peptidase_M48: Peptidase family M48 This is family M48 in the peptidase classification Back     alignment and domain information
>cd06456 M3A_DCP_Oligopeptidase_A Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3 Back     alignment and domain information
>COG2989 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd06457 M3A_MIP Peptidase M3 mitochondrial intermediate peptidase (MIP; EC 3 Back     alignment and domain information
>PRK02870 heat shock protein HtpX; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
1su3_A 450 X-Ray Structure Of Human Prommp-1: New Insights Int 1e-28
1slm_A255 Crystal Structure Of Fibroblast Stromelysin-1: The 2e-25
1fbl_A 370 Structure Of Full-Length Porcine Synovial Collagena 6e-25
2j0t_A170 Crystal Structure Of The Catalytic Domain Of Mmp-1 2e-23
3ayk_A169 Catalytic Fragment Of Human Fibroblast Collagenase 2e-23
1cgl_A169 Structure Of The Catalytic Domain Of Fibroblast Col 8e-23
3shi_A156 Crystal Structure Of Human Mmp1 Catalytic Domain At 8e-23
1cge_A168 Crystal Structures Of Recombinant 19-Kda Human Fibr 9e-23
1cgf_A162 Crystal Structures Of Recombinant 19-Kda Human Fibr 1e-22
2clt_A 367 Crystal Structure Of The Active Form (Full-Length) 1e-22
2xs4_A167 Structure Of Karilysin Catalytic Mmp Domain In Comp 6e-22
2xs3_A166 Structure Of Karilysin Catalytic Mmp Domain Length 7e-22
3ayu_A167 Crystal Structure Of Mmp-2 Active Site Mutant In Co 7e-22
966c_A157 Crystal Structure Of Fibroblast Collagenase-1 Compl 1e-21
1cxv_A164 Structure Of Recombinant Mouse Collagenase-3 (Mmp-1 1e-21
1hov_A163 Solution Structure Of A Catalytic Domain Of Mmp-2 C 2e-21
2ow9_A170 Crystal Structure Analysis Of The Mmp13 Catalytic D 6e-21
1fls_A165 Solution Structure Of The Catalytic Fragment Of Hum 6e-21
2d1n_A166 Collagenase-3 (Mmp-13) Complexed To A Hydroxamic Ac 6e-21
3kry_A164 Crystal Structure Of Mmp-13 In Complex With Sc-7808 7e-21
3kec_A167 Crystal Structure Of Human Mmp-13 Complexed With A 7e-21
1eub_A171 Solution Structure Of The Catalytic Domain Of Human 7e-21
456c_A168 Crystal Structure Of Collagenase-3 (Mmp-13) Complex 7e-21
4a7b_A169 Mmp13 In Complex With A Novel Selective Non Zinc Bi 8e-21
2jsd_A160 Solution Structure Of Mmp20 Complexed With Nngh Len 9e-21
1gkc_A163 Mmp9-inhibitor Complex Length = 163 2e-20
3ljz_A164 Crystal Structure Of Human Mmp-13 Complexed With An 2e-20
1qib_A161 Crystal Structure Of Gelatinase A Catalytic Domain 4e-20
1gkd_A163 Mmp9 Active Site Mutant-Inhibitor Complex Length = 4e-20
2ovx_A159 Mmp-9 Active Site Mutant With Barbiturate Inhibitor 5e-20
1q3a_A165 Crystal Structure Of The Catalytic Domain Of Human 5e-20
1rm8_A169 Crystal Structure Of The Catalytic Domain Of Mmp-16 8e-20
3v96_B165 Complex Of Matrix Metalloproteinase-10 Catalytic Do 1e-19
1eak_A 421 Catalytic Domain Of Prommp-2 E404q Mutant Length = 2e-19
1eak_A421 Catalytic Domain Of Prommp-2 E404q Mutant Length = 2e-05
1ck7_A 631 Gelatinase A (Full-Length) Length = 631 2e-19
1ck7_A 631 Gelatinase A (Full-Length) Length = 631 6e-05
2k2g_A165 Solution Structure Of The Wild-Type Catalytic Domai 3e-19
1jiz_A166 Crystal Structure Analysis Of Human Macrophage Elas 3e-19
2z2d_A164 Solution Structure Of Human Macrophage Elastase (Mm 3e-19
1hv5_A165 Crystal Structure Of The Stromelysin-3 (Mmp-11) Cat 5e-19
1biw_A173 Design And Synthesis Of Conformationally-Constraine 5e-19
1usn_A165 Crystal Structure Of The Catalytic Domain Of Human 5e-19
1ums_A174 Stromelysin-1 Catalytic Domain With Hydrophobic Inh 5e-19
3oho_A169 Catalytic Domain Of Stromelysin-1 In Complex With N 5e-19
1b8y_A167 X-Ray Structure Of Human Stromelysin Catalytic Doma 5e-19
2d1o_A171 Stromelysin-1 (Mmp-3) Complexed To A Hydroxamic Aci 6e-19
1caq_A168 X-Ray Structure Of Human Stromelysin Catalytic Doma 6e-19
1jaq_A163 Complex Of 1-Hydroxylamine-2-Isobutylmalonyl-Ala-Gl 9e-19
1kbc_A164 Procarboxypeptidase Ternary Complex Length = 164 9e-19
1bzs_A165 Crystal Structure Of Mmp8 Complexed With Hmr2909 Le 1e-18
1c8t_A167 Human Stromelysin-1 (E202q) Catalytic Domain Comple 2e-18
4gr8_A152 Crystal Structure Of The Catalytic Domain Of Human 2e-18
2k9c_A152 Paramagnetic Shifts In Solid-State Nmr Of Proteins 2e-18
2poj_A164 Nmr Solution Structure Of The Inhibitor-Free State 2e-18
1os2_A165 Ternary Enzyme-Product-Inhibitor Complexes Of Human 2e-18
3ba0_A 365 Crystal Structure Of Full-Length Human Mmp-12 Lengt 2e-18
1rmz_A159 Crystal Structure Of The Catalytic Domain Of Human 2e-18
3f15_A158 Crystal Structure Of The Catalytic Domain Of Human 3e-18
1uea_A173 Mmp-3TIMP-1 Complex Length = 173 3e-18
2wo8_A164 Mmp12 Complex With A Beta Hydroxy Carboxylic Acid L 3e-18
1ros_A163 Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dio 4e-18
1utt_A159 Crystal Structure Of Mmp-12 Complexed To 2- (1,3-Di 4e-18
3tt4_A159 Human Mmp8 In Complex With L-Glutamate Motif Inhibi 6e-18
1mnc_A163 Structure Of Human Neutrophil Collagenase Reveals L 1e-17
2ddy_A173 Solution Structure Of Matrilysin (Mmp-7) Complexed 2e-17
2jnp_A161 Solution Structure Of Matrix Metalloproteinase 3 (M 2e-17
2y6d_A174 The Discovery Of Mmp7 Inhibitors Exploiting A Novel 2e-17
1mmp_A170 Matrilysin Complexed With Carboxylate Inhibitor Len 2e-17
1hfs_A160 Crystal Structure Of The Catalytic Domain Of Human 2e-17
2w0d_A164 Does A Fast Nuclear Magnetic Resonance Spectroscopy 2e-17
1a86_A158 Mmp8 With Malonic And Aspartic Acid Based Inhibitor 2e-17
2y6c_A165 The Discovery Of Mmp7 Inhibitors Exploiting A Novel 2e-17
1jk3_A158 Crystal Structure Of Human Mmp-12 (Macrophage Elast 2e-17
1qic_A161 Crystal Structure Of Stromelysin Catalytic Domain L 3e-17
1qia_A162 Crystal Structure Of Stromelysin Catalytic Domain L 4e-17
3ma2_D181 Complex Membrane Type-1 Matrix Metalloproteinase (M 4e-15
1bqq_M174 Crystal Structure Of The Mt1-Mmp--Timp-2 Complex Le 4e-15
1l6j_A 425 Crystal Structure Of Human Matrix Metalloproteinase 6e-12
1l6j_A425 Crystal Structure Of Human Matrix Metalloproteinase 2e-08
>pdb|1SU3|A Chain A, X-Ray Structure Of Human Prommp-1: New Insights Into Collagenase Action Length = 450 Back     alignment and structure 
Iteration: 1

 Score =  122 bits (306), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/226 (35%), Positives = 112/226 (49%), Gaps = 36/226 (15%)
Query: 1   MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSH 60
           +K  Q  + L  TG  D  T+ +M +PRCGV D                        V+ 
Sbjct: 45  LKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPD------------------------VAQ 80
Query: 61  YEFFPGRPRWPPSNSHLTYAFLPGTP----AEAINAVGRAFQTWAAISHFKFSQTQDYTN 116
           +    G PRW    +HLTY     TP    A+  +A+ +AFQ W+ ++   F++  +   
Sbjct: 81  FVLTEGNPRW--EQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSE-GQ 137
Query: 117 ANLKISFQRGWHGDSSPFDGRGGTIAHAAPP---RGGIFDYDADEQWAVGARPGAFDLET 173
           A++ ISF RG H D+SPFDG GG +AHA  P    GG   +D DE+W    R   ++L  
Sbjct: 138 ADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFR--EYNLHR 195
Query: 174 VALHEIGHLLGLDHSLVEGAIMYAYIDPGATKGLHTDDVQGIRALY 219
           VA HE+GH LGL HS   GA+MY          L  DD+ GI+A+Y
Sbjct: 196 VAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIY 241
>pdb|1SLM|A Chain A, Crystal Structure Of Fibroblast Stromelysin-1: The C-Truncated Human Proenzyme Length = 255 Back     alignment and structure
>pdb|1FBL|A Chain A, Structure Of Full-Length Porcine Synovial Collagenase (Mmp1) Reveals A C-Terminal Domain Containing A Calcium-Linked, Four-Bladed Beta- Propeller Length = 370 Back     alignment and structure
>pdb|2J0T|A Chain A, Crystal Structure Of The Catalytic Domain Of Mmp-1 In Complex With The Inhibitory Domain Of Timp-1 Length = 170 Back     alignment and structure
>pdb|3AYK|A Chain A, Catalytic Fragment Of Human Fibroblast Collagenase Complexed With Cgs-27023a, Nmr, Minimized Average Structure Length = 169 Back     alignment and structure
>pdb|1CGL|A Chain A, Structure Of The Catalytic Domain Of Fibroblast Collagenase Complexed With An Inhibitor Length = 169 Back     alignment and structure
>pdb|3SHI|A Chain A, Crystal Structure Of Human Mmp1 Catalytic Domain At 2.2 A Resolution Length = 156 Back     alignment and structure
>pdb|1CGE|A Chain A, Crystal Structures Of Recombinant 19-Kda Human Fibroblast Collagenase Complexed To Itself Length = 168 Back     alignment and structure
>pdb|1CGF|A Chain A, Crystal Structures Of Recombinant 19-Kda Human Fibroblast Collagenase Complexed To Itself Length = 162 Back     alignment and structure
>pdb|2CLT|A Chain A, Crystal Structure Of The Active Form (Full-Length) Of Human Fibroblast Collagenase. Length = 367 Back     alignment and structure
>pdb|2XS4|A Chain A, Structure Of Karilysin Catalytic Mmp Domain In Complex With Magnesium Length = 167 Back     alignment and structure
>pdb|2XS3|A Chain A, Structure Of Karilysin Catalytic Mmp Domain Length = 166 Back     alignment and structure
>pdb|3AYU|A Chain A, Crystal Structure Of Mmp-2 Active Site Mutant In Complex With App- Drived Decapeptide Inhibitor Length = 167 Back     alignment and structure
>pdb|966C|A Chain A, Crystal Structure Of Fibroblast Collagenase-1 Complexed To A Diphenyl-Ether Sulphone Based Hydroxamic Acid Length = 157 Back     alignment and structure
>pdb|1CXV|A Chain A, Structure Of Recombinant Mouse Collagenase-3 (Mmp-13) Length = 164 Back     alignment and structure
>pdb|1HOV|A Chain A, Solution Structure Of A Catalytic Domain Of Mmp-2 Complexed With Sc-74020 Length = 163 Back     alignment and structure
>pdb|2OW9|A Chain A, Crystal Structure Analysis Of The Mmp13 Catalytic Domain In Complex With Specific Inhibitor Length = 170 Back     alignment and structure
>pdb|1FLS|A Chain A, Solution Structure Of The Catalytic Fragment Of Human Collagenase-3 (Mmp-13) Complexed With A Hydroxamic Acid Inhibitor Length = 165 Back     alignment and structure
>pdb|2D1N|A Chain A, Collagenase-3 (Mmp-13) Complexed To A Hydroxamic Acid Inhibitor Length = 166 Back     alignment and structure
>pdb|3KRY|A Chain A, Crystal Structure Of Mmp-13 In Complex With Sc-78080 Length = 164 Back     alignment and structure
>pdb|3KEC|A Chain A, Crystal Structure Of Human Mmp-13 Complexed With A Phenyl-2h-Tetrazole Compound Length = 167 Back     alignment and structure
>pdb|1EUB|A Chain A, Solution Structure Of The Catalytic Domain Of Human Collagenase-3 (Mmp-13) Complexed To A Potent Non-Peptidic Sulfonamide Inhibitor Length = 171 Back     alignment and structure
>pdb|456C|A Chain A, Crystal Structure Of Collagenase-3 (Mmp-13) Complexed To A Diphenyl-Ether Sulphone Based Hydroxamic Acid Length = 168 Back     alignment and structure
>pdb|4A7B|A Chain A, Mmp13 In Complex With A Novel Selective Non Zinc Binding Inhibitor Cmpd22 Length = 169 Back     alignment and structure
>pdb|2JSD|A Chain A, Solution Structure Of Mmp20 Complexed With Nngh Length = 160 Back     alignment and structure
>pdb|1GKC|A Chain A, Mmp9-inhibitor Complex Length = 163 Back     alignment and structure
>pdb|3LJZ|A Chain A, Crystal Structure Of Human Mmp-13 Complexed With An Amino-2-Indanol Compound Length = 164 Back     alignment and structure
>pdb|1QIB|A Chain A, Crystal Structure Of Gelatinase A Catalytic Domain Length = 161 Back     alignment and structure
>pdb|1GKD|A Chain A, Mmp9 Active Site Mutant-Inhibitor Complex Length = 163 Back     alignment and structure
>pdb|2OVX|A Chain A, Mmp-9 Active Site Mutant With Barbiturate Inhibitor Length = 159 Back     alignment and structure
>pdb|1Q3A|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Matrix Metalloproteinase 10 Length = 165 Back     alignment and structure
>pdb|1RM8|A Chain A, Crystal Structure Of The Catalytic Domain Of Mmp-16MT3- Mmp: Characterization Of Mt-Mmp Specific Features Length = 169 Back     alignment and structure
>pdb|3V96|B Chain B, Complex Of Matrix Metalloproteinase-10 Catalytic Domain (Mmp-10cd) With Tissue Inhibitor Of Metalloproteinases-1 (Timp-1) Length = 165 Back     alignment and structure
>pdb|1EAK|A Chain A, Catalytic Domain Of Prommp-2 E404q Mutant Length = 421 Back     alignment and structure
>pdb|1EAK|A Chain A, Catalytic Domain Of Prommp-2 E404q Mutant Length = 421 Back     alignment and structure
>pdb|1CK7|A Chain A, Gelatinase A (Full-Length) Length = 631 Back     alignment and structure
>pdb|1CK7|A Chain A, Gelatinase A (Full-Length) Length = 631 Back     alignment and structure
>pdb|2K2G|A Chain A, Solution Structure Of The Wild-Type Catalytic Domain Of Human Matrix Metalloproteinase 12 (Mmp-12) In Complex With A Tight-Binding Inhibitor Length = 165 Back     alignment and structure
>pdb|1JIZ|A Chain A, Crystal Structure Analysis Of Human Macrophage Elastase Mmp- 12 Length = 166 Back     alignment and structure
>pdb|2Z2D|A Chain A, Solution Structure Of Human Macrophage Elastase (Mmp-12) Catalytic Domain Complexed With A Gamma-Keto Butanoic Acid Inhibitor Length = 164 Back     alignment and structure
>pdb|1HV5|A Chain A, Crystal Structure Of The Stromelysin-3 (Mmp-11) Catalytic Domain Complexed With A Phosphinic Inhibitor Length = 165 Back     alignment and structure
>pdb|1BIW|A Chain A, Design And Synthesis Of Conformationally-Constrained Mmp Inhibitors Length = 173 Back     alignment and structure
>pdb|1USN|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Fibroblast Stromelysin-1 Inhibited With Thiadiazole Inhibitor Pnu-142372 Length = 165 Back     alignment and structure
>pdb|1UMS|A Chain A, Stromelysin-1 Catalytic Domain With Hydrophobic Inhibitor Bound, Ph 7.0, 32oc, 20 Mm Cacl2, 15% Acetonitrile; Nmr Ensemble Of 20 Structures Length = 174 Back     alignment and structure
>pdb|3OHO|A Chain A, Catalytic Domain Of Stromelysin-1 In Complex With N-Hydroxy-2-(4- Methylphenylsulfonamido)acetamide Length = 169 Back     alignment and structure
>pdb|1B8Y|A Chain A, X-Ray Structure Of Human Stromelysin Catalytic Domain Complexed With Non-Peptide Inhibitors: Implications For Inhibitor Selectivity Length = 167 Back     alignment and structure
>pdb|2D1O|A Chain A, Stromelysin-1 (Mmp-3) Complexed To A Hydroxamic Acid Inhibitor Length = 171 Back     alignment and structure
>pdb|1CAQ|A Chain A, X-Ray Structure Of Human Stromelysin Catalytic Domain Complexes With Non-Peptide Inhibitors: Implication For Inhibitor Selectivity Length = 168 Back     alignment and structure
>pdb|1JAQ|A Chain A, Complex Of 1-Hydroxylamine-2-Isobutylmalonyl-Ala-Gly-Nh2 With The Catalytic Domain Of Matrix Metallo Proteinase-8 (Met80 Form) Length = 163 Back     alignment and structure
>pdb|1KBC|A Chain A, Procarboxypeptidase Ternary Complex Length = 164 Back     alignment and structure
>pdb|1BZS|A Chain A, Crystal Structure Of Mmp8 Complexed With Hmr2909 Length = 165 Back     alignment and structure
>pdb|1C8T|A Chain A, Human Stromelysin-1 (E202q) Catalytic Domain Complexed With Ro-26-2812 Length = 167 Back     alignment and structure
>pdb|4GR8|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 In Complex With Selective Phosphinic Inhibitor Rxp470c Length = 152 Back     alignment and structure
>pdb|2K9C|A Chain A, Paramagnetic Shifts In Solid-State Nmr Of Proteins To Elicit Structural Information Length = 152 Back     alignment and structure
>pdb|2POJ|A Chain A, Nmr Solution Structure Of The Inhibitor-Free State Of Macrophage Metalloelastase (Mmp-12) Length = 164 Back     alignment and structure
>pdb|1OS2|A Chain A, Ternary Enzyme-Product-Inhibitor Complexes Of Human Mmp12 Length = 165 Back     alignment and structure
>pdb|3BA0|A Chain A, Crystal Structure Of Full-Length Human Mmp-12 Length = 365 Back     alignment and structure
>pdb|1RMZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 Complexed With The Inhibitor Nngh At 1.3 A Resolution Length = 159 Back     alignment and structure
>pdb|3F15|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 Complexed With The Inhibitor (S)-N-(2,3-Dihydroxypropyl)-4- Methoxy-N-(2-Nitroso-2-Oxoethyl)benzenesulfonamide Length = 158 Back     alignment and structure
>pdb|1UEA|A Chain A, Mmp-3TIMP-1 Complex Length = 173 Back     alignment and structure
>pdb|2WO8|A Chain A, Mmp12 Complex With A Beta Hydroxy Carboxylic Acid Length = 164 Back     alignment and structure
>pdb|1ROS|A Chain A, Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dioxo-1,3- Dihydro-2h-Isoindol-2-Yl)ethyl-4-(4-Ethoxy[1, 1-Biphenyl]-4- Yl)-4-Oxobutanoic Acid Length = 163 Back     alignment and structure
>pdb|1UTT|A Chain A, Crystal Structure Of Mmp-12 Complexed To 2- (1,3-Dioxo-1,3-Dihydro-2h-Isoindol-2-Yl)ethyl-4- (4-Ethoxy[1,1-Biphenyl]-4-Yl)-4-Oxobutanoic Acid Length = 159 Back     alignment and structure
>pdb|3TT4|A Chain A, Human Mmp8 In Complex With L-Glutamate Motif Inhibitor Length = 159 Back     alignment and structure
>pdb|1MNC|A Chain A, Structure Of Human Neutrophil Collagenase Reveals Large S1' Specificity Pocket Length = 163 Back     alignment and structure
>pdb|2DDY|A Chain A, Solution Structure Of Matrilysin (Mmp-7) Complexed To Constraint Conformational Sulfonamide Inhibitor Length = 173 Back     alignment and structure
>pdb|2JNP|A Chain A, Solution Structure Of Matrix Metalloproteinase 3 (Mmp-3) In The Presence Of N-Isobutyl-N-[4- Methoxyphenylsulfonyl]glycyl Hydroxamic Acid (Nngh) Length = 161 Back     alignment and structure
>pdb|2Y6D|A Chain A, The Discovery Of Mmp7 Inhibitors Exploiting A Novel Selectivity Trigger Length = 174 Back     alignment and structure
>pdb|1MMP|A Chain A, Matrilysin Complexed With Carboxylate Inhibitor Length = 170 Back     alignment and structure
>pdb|1HFS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Fibroblast Stromelysin-1 Inhibited With The N-Carboxy-Alkyl Inhibitor L-764,004 Length = 160 Back     alignment and structure
>pdb|2W0D|A Chain A, Does A Fast Nuclear Magnetic Resonance Spectroscopy- And X-Ray Crystallography Hybrid Approach Provide Reliable Structural Information Of Ligand-Protein Complexes? A Case Study Of Metalloproteinases. Length = 164 Back     alignment and structure
>pdb|1A86|A Chain A, Mmp8 With Malonic And Aspartic Acid Based Inhibitor Length = 158 Back     alignment and structure
>pdb|2Y6C|A Chain A, The Discovery Of Mmp7 Inhibitors Exploiting A Novel Selectivity Trigger Length = 165 Back     alignment and structure
>pdb|1JK3|A Chain A, Crystal Structure Of Human Mmp-12 (Macrophage Elastase) At True Atomic Resolution Length = 158 Back     alignment and structure
>pdb|1QIC|A Chain A, Crystal Structure Of Stromelysin Catalytic Domain Length = 161 Back     alignment and structure
>pdb|1QIA|A Chain A, Crystal Structure Of Stromelysin Catalytic Domain Length = 162 Back     alignment and structure
>pdb|3MA2|D Chain D, Complex Membrane Type-1 Matrix Metalloproteinase (Mt1-Mmp) With Tissue Inhibitor Of Metalloproteinase-1 (Timp-1) Length = 181 Back     alignment and structure
>pdb|1BQQ|M Chain M, Crystal Structure Of The Mt1-Mmp--Timp-2 Complex Length = 174 Back     alignment and structure
>pdb|1L6J|A Chain A, Crystal Structure Of Human Matrix Metalloproteinase Mmp9 (gelatinase B) Length = 425 Back     alignment and structure
>pdb|1L6J|A Chain A, Crystal Structure Of Human Matrix Metalloproteinase Mmp9 (gelatinase B) Length = 425 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 2e-45
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 6e-45
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 2e-42
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 3e-42
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 2e-40
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 5e-40
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 6e-40
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 1e-38
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 1e-38
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 2e-38
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 3e-38
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 2e-37
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 6e-37
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 2e-35
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 5e-35
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 7e-30
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 9e-24
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 3e-15
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 1e-22
1l6j_A425 Matrix metalloproteinase-9; twisted beta sheet fla 4e-20
1eak_A421 72 kDa type IV collagenase; hydrolase-hydrolase in 3e-22
1eak_A 421 72 kDa type IV collagenase; hydrolase-hydrolase in 8e-20
1k7i_A 479 PROC, secreted protease C; metalloprotease, hydrol 8e-09
1sat_A 471 Serratia protease; parallel beta helix, parallel b 2e-07
1g9k_A 463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pse 1e-06
1kap_P 479 Alkaline protease; calcium binding protein, zinc m 7e-05
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Length = 255 Back     alignment and structure
 Score =  150 bits (380), Expect = 2e-45
 Identities = 72/226 (31%), Positives = 98/226 (43%), Gaps = 35/226 (15%)

Query: 2   KTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSHY 61
           +  Q    L  TG LD +T+ +M +PRCGV D                        V H+
Sbjct: 48  REMQKFLGLEVTGKLDSDTLEVMRKPRCGVPD------------------------VGHF 83

Query: 62  EFFPGRPRWPPSNSHLTYAFLPG--TPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANL 119
             FPG P+W  ++                  +AV +A + W  ++   FS+  +   A++
Sbjct: 84  RTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYE-GEADI 142

Query: 120 KISFQRGWHGDSSPFDGRGGTIAHAAPP---RGGIFDYDADEQWAVGARPGAFDLETVAL 176
            ISF    HGD  PFDG G  +AHA  P     G   +D DEQW         +L  VA 
Sbjct: 143 MISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKD--TTGTNLFLVAA 200

Query: 177 HEIGHLLGLDHSLVEGAIM---YAYIDPGATKGLHTDDVQGIRALY 219
           HEIGH LGL HS    A+M   Y  +       L  DD+ GI++LY
Sbjct: 201 HEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLY 246
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Length = 450 Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Length = 168 Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Length = 167 Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Length = 168 Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Length = 167 Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Length = 173 Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Length = 165 Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Length = 163 Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Length = 159 Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Length = 174 Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Length = 159 Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Length = 169 Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} PDB: 1bqq_M 1buv_M Length = 181 Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Length = 365 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Length = 479 Back     alignment and structure
>1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A* 1smp_A 1srp_A Length = 471 Back     alignment and structure
>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Length = 463 Back     alignment and structure
>1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Length = 479 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
1eak_A421 72 kDa type IV collagenase; hydrolase-hydrolase in 100.0
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 100.0
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 100.0
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 100.0
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 100.0
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 100.0
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 100.0
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 100.0
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 100.0
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 100.0
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 100.0
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 100.0
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 100.0
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 100.0
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 100.0
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 100.0
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 100.0
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 100.0
1kap_P 479 Alkaline protease; calcium binding protein, zinc m 100.0
1k7i_A 479 PROC, secreted protease C; metalloprotease, hydrol 100.0
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 100.0
1g9k_A 463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pse 100.0
1sat_A 471 Serratia protease; parallel beta helix, parallel b 100.0
1c7k_A132 NCNP, zinc endoprotease; alpha and beta protein, m 99.91
3edh_A201 Bone morphogenetic protein 1; vicinal disulfide, a 99.78
3lq0_A235 Proastacin; metallopeptidase, zymogen activation, 99.74
3lqb_A199 Hatching enzyme, LOC792177 protein; hydrolase, met 99.73
4gwm_A 592 Meprin A subunit beta; mulidomain structure, hydro 99.55
3p24_A397 BFT-3; metzincins, metalloendopeptidase, hydrolase 99.2
4axq_A163 Archaemetzincin; metalloprotease, protease, hydrol 97.74
2x7m_A195 Archaemetzincin; metalloprotease, protease, hydrol 97.72
1qua_A197 Acutolysin-C, hemorrhagin III; metalloprotease, he 97.71
1yp1_A202 FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} 97.71
3lmc_A210 Peptidase, zinc-dependent; structural genomics, PS 97.69
2cki_A262 Ulilysin; metalloprotease, hydrolase; HET: ARG; 1. 97.64
1kuf_A203 Atrolysin E, metalloproteinase; alpha/beta protein 97.63
1bud_A197 Protein (acutolysin A); metalloproteinase, snake v 97.58
2w15_A202 Zinc metalloproteinase BAP1; hydrolase inhibitor c 97.55
1r55_A214 ADAM 33; metalloprotease, inhibitor, asthma, hydro 97.4
2dw0_A 419 Catrocollastatin; apoptotic toxin, SVMP, metallopr 97.39
1atl_A202 Atrolysin C; metalloendopeptidase, hydrolase-hydro 97.38
2e3x_A 427 Coagulation factor X-activating enzyme light CHAI; 97.37
2ero_A 427 VAP-1, vascular apoptosis-inducing protein 1; meta 97.3
3b8z_A217 Protein adamts-5; alpha/beta, hydrolase; HET: 294; 97.29
4dd8_A208 Disintegrin and metalloproteinase domain-containi 97.12
2ddf_A257 ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapi 97.06
2v4b_A300 Adamts-1; zymogen, protease, hydrolase, metallopro 96.98
2rjp_A 316 Adamts-4; metalloprotease domain, aggrecanase, cle 96.97
2i47_A288 ADAM 17; TACE-inhibitor complex, hydrolase; HET: I 96.94
2rjq_A 378 Adamts-5; metalloprotease domain, aggrecanase, cle 96.89
3k7n_A 397 K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A { 96.76
3k7l_A 422 Atragin; SVMP, metalloprotease, hydrolase; HET: NA 96.7
1lml_A 478 Leishmanolysin; metalloprotease, glycoprotein; 1.8 96.65
3g5c_A 510 ADAM 22; alpha/beta fold, cross-linked domain, cel 95.13
1lbu_A213 Muramoyl-pentapeptide carboxypeptidase; hydrolase, 93.32
3ujz_A 869 Metalloprotease STCE; mucin-type glycoprotein, hyd 92.58
4fet_B222 Spore cortex-lytic enzyme prepeptide; transglycosy 91.7
3bkh_A268 Phikz144, lytic transglycosylase; bacteriophage, e 91.38
3cqb_A107 Probable protease HTPX homolog; heat shock protein 87.84
3e11_A114 Predicted zincin-like metalloprotease; DUF1025 fam 87.6
3p1v_A407 Metallo-endopeptidase; structural genomics, joint 86.41
3c37_A 253 Peptidase, M48 family; Q74D82, GSR143A, structural 80.84
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Back     alignment and structure
Probab=100.00  E-value=1.5e-62  Score=436.16  Aligned_cols=194  Identities=40%  Similarity=0.741  Sum_probs=176.9

Q ss_pred             ChhhhhcCCCCCccCCCHHHHHHhcCCCCCCCCCCCCcccccCCCcccCCCCCcccccceeeeCCCCCCCCCCCceeEEE
Q 039411            1 MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSHYEFFPGRPRWPPSNSHLTYA   80 (222)
Q Consensus         1 i~~~Q~~~~L~~TG~ld~~T~~~m~~pRCg~pD~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~W~~~~~~lty~   80 (222)
                      ||+||+|+||||||+||++|+++|++|||||||+.                        +|.+++++.||.  +++|||+
T Consensus        43 i~~~Q~f~gL~vTG~LD~~T~~~M~~PRCGvpD~~------------------------~~~~~~~~~kW~--k~~LTY~   96 (421)
T 1eak_A           43 LKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVA------------------------NYNFFPRKPKWD--KNQITYR   96 (421)
T ss_dssp             HHHHHHHSSCCCCCSCCHHHHHHHTSCBCSSCSSC------------------------SSCCSSCCCCCS--SSEEEEE
T ss_pred             HHHHHHHcCCCCCCccCHHHHHHhcCCCCCCCCcc------------------------ccccccCCcccc--cceEEEE
Confidence            68999999999999999999999999999999983                        345567889999  9999999


Q ss_pred             ecCCCh----HHHHHHHHHHHHHHHhcccceEEEecCCCCceEEEEEeecCCCCCCCCCCCCCeeeeecCCC---Cceee
Q 039411           81 FLPGTP----AEAINAVGRAFQTWAAISHFKFSQTQDYTNANLKISFQRGWHGDSSPFDGRGGTIAHAAPPR---GGIFD  153 (222)
Q Consensus        81 ~~~~~~----~~~~~~i~~A~~~W~~~~~l~F~ev~~~~~adI~I~f~~~~~gd~~~f~g~g~~la~a~~P~---~g~i~  153 (222)
                      |.++++    .+++++|++||++|++|++|+|+||.+. .|||+|.|.+++|||++||||+||+|||||+|.   .|++|
T Consensus        97 i~~~~~~l~~~~v~~~i~~AF~~Ws~vtpLtF~ev~~~-~ADI~I~F~~g~HgD~~pFDG~gg~LAHAf~P~~g~~Gd~H  175 (421)
T 1eak_A           97 IIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDG-EADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSH  175 (421)
T ss_dssp             ECCCCTTSCHHHHHHHHHHHHHHHHTSSSCEEEECCSS-CCSEEEEEECSSCSSSCCCCSSSSBCEEECCSSSTTTTCEE
T ss_pred             EecCCCCCCHHHHHHHHHHHHHHHhcccCceeEEcCCC-CCCEEEEEecCCCCCccccCCCCCccccccCCCCCCCCcee
Confidence            998753    3789999999999999999999999876 999999999999999999999999999999995   79999


Q ss_pred             ecCCCCcccCCC--------------------------------------------------------------------
Q 039411          154 YDADEQWAVGAR--------------------------------------------------------------------  165 (222)
Q Consensus       154 fd~~~~w~~~~~--------------------------------------------------------------------  165 (222)
                      ||++|.|+++..                                                                    
T Consensus       176 FD~dE~Wt~~~~~~~~~~~g~~~~~~C~fPF~~~g~~~~~Ct~~g~~~g~~WCstt~~yd~d~~~~~C~~~~~~~~~gn~  255 (421)
T 1eak_A          176 FDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNA  255 (421)
T ss_dssp             EETTSCEESSSSCCCBCBSGGGTTSBCCSSEEETTEEESSCBCTTCSSCCCEEESSSBTTTSCCEEECCCTTTCCCSTTT
T ss_pred             eeeccceeccCCcceeeecccCCCCcccCCeEECCceeccccccCccCCCceeccccccCcCCceeecCCcceeecccCC
Confidence            999999988642                                                                    


Q ss_pred             --------------------------------------------------------------------------------
Q 039411          166 --------------------------------------------------------------------------------  165 (222)
Q Consensus       166 --------------------------------------------------------------------------------  165 (222)
                                                                                                      
T Consensus       256 ~~~~C~FPF~~~~~~y~~Ct~~g~~dg~~WC~tt~~yd~d~~~~~C~~~~~~~~~gn~~G~pC~fPF~~~~~~y~~Ct~~  335 (421)
T 1eak_A          256 EGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSA  335 (421)
T ss_dssp             TTCCCCSSEEETTEEESSCBCTTCSSCCCEEESSSCTTTSCCEEECCCCCCSCBSTTTTTCCCCSSEEETTEEESSCBCT
T ss_pred             CCCcccCceeeCCeeeccccccCcccCceeeecccccCccccccccCcccceeeccCCCCCceeeeEEEcceEEEecccc
Confidence                                                                                            


Q ss_pred             -------------------------CCccchhHHHHHhhhhhcCCCCCCCCCCceeeeeCCCCCCCCCHhhHHHHHHHhc
Q 039411          166 -------------------------PGAFDLETVALHEIGHLLGLDHSLVEGAIMYAYIDPGATKGLHTDDVQGIRALYN  220 (222)
Q Consensus       166 -------------------------~~~~~~~~va~HEiGHaLGL~Hs~~~~siM~p~~~~~~~~~l~~~Di~~iq~LYg  220 (222)
                                               ..+.+++.||+|||||+|||.||.+++|||+|+|.++....|+++||++||+|||
T Consensus       336 Gr~~g~~WCatt~~fD~DekWg~Cp~~g~~l~~va~HE~GHaLGL~Hs~~~~avM~p~Y~~~~~~~l~~dDi~gIq~LYG  415 (421)
T 1eak_A          336 GRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHQFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG  415 (421)
T ss_dssp             TCSSSCCEEESSSCHHHHCCEEECCCCCEEHHHHHHHHHHHHTTCCCCSCTTSTTCSBCCCCSSCCCCHHHHHHHHHHHC
T ss_pred             CCcCCceeeeeccccccccceEeeccccccchhhhhhhhhhccCCCCCCCCCCccccccccCCCCCCCHHHHHHHHHHhC
Confidence                                     0124788999999999999999999999999999976677999999999999999


Q ss_pred             C
Q 039411          221 N  221 (222)
Q Consensus       221 ~  221 (222)
                      +
T Consensus       416 ~  416 (421)
T 1eak_A          416 A  416 (421)
T ss_dssp             C
T ss_pred             C
Confidence            6
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Back     alignment and structure
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} SCOP: d.92.1.11 PDB: 1bqq_M 1buv_M Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Back     alignment and structure
>1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Back     alignment and structure
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Back     alignment and structure
>1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A* 1smp_A 1srp_A Back     alignment and structure
>1c7k_A NCNP, zinc endoprotease; alpha and beta protein, metalloproteinase, hydrolase; 1.00A {Streptomyces caespitosus} SCOP: d.92.1.1 PDB: 1kuh_A Back     alignment and structure
>3edh_A Bone morphogenetic protein 1; vicinal disulfide, alternative splicing, calcium, chondrogenesis, cleavage on PAIR of basic residues, cytokine; 1.25A {Homo sapiens} SCOP: d.92.1.0 PDB: 3edg_A 3edi_A Back     alignment and structure
>3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, D bond, hydrolase, metal-binding, metalloprotease, zymogen; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A Back     alignment and structure
>3lqb_A Hatching enzyme, LOC792177 protein; hydrolase, metalloprotease, astacin, metal- protease; 1.10A {Danio rerio} Back     alignment and structure
>4gwm_A Meprin A subunit beta; mulidomain structure, hydrolase; HET: NAG BMA FUC MAN; 1.85A {Homo sapiens} PDB: 4gwn_A* Back     alignment and structure
>3p24_A BFT-3; metzincins, metalloendopeptidase, hydrolase; HET: PG4; 1.80A {Bacteroides fragilis} Back     alignment and structure
>4axq_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.40A {Archaeoglobus fulgidus} PDB: 2xhq_A 3zvs_A 4a3w_A* Back     alignment and structure
>2x7m_A Archaemetzincin; metalloprotease, protease, hydrolase, metal-bindi; 1.50A {Methanopyrus kandleri} Back     alignment and structure
>1qua_A Acutolysin-C, hemorrhagin III; metalloprotease, hemorrhagic toxin, snake venom proteinase; 2.20A {Deinagkistrodon acutus} SCOP: d.92.1.9 Back     alignment and structure
>1yp1_A FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} Back     alignment and structure
>3lmc_A Peptidase, zinc-dependent; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, MUR16; 2.00A {Methanocorpusculum labreanum} Back     alignment and structure
>2cki_A Ulilysin; metalloprotease, hydrolase; HET: ARG; 1.7A {Methanosarcina acetivorans} PDB: 2j83_A* 3lum_A* 3lun_A* Back     alignment and structure
>1kuf_A Atrolysin E, metalloproteinase; alpha/beta protein, hydrolase; 1.35A {Protobothrops mucrosquamatus} SCOP: d.92.1.9 PDB: 1kui_A 1kuk_A 1kug_A 1wni_A Back     alignment and structure
>1bud_A Protein (acutolysin A); metalloproteinase, snake venom, MMP, toxin; 1.90A {Deinagkistrodon acutus} SCOP: d.92.1.9 PDB: 1bsw_A Back     alignment and structure
>2w15_A Zinc metalloproteinase BAP1; hydrolase inhibitor complex, metal-binding, zinc-depending, metalloprotease, metalloproteinase/inhibitor complex; HET: WR2; 1.05A {Bothrops asper} PDB: 2w12_A* 2w13_A* 2w14_A* 1nd1_A 3gbo_A Back     alignment and structure
>1r55_A ADAM 33; metalloprotease, inhibitor, asthma, hydrolase; HET: NAG MAN 097; 1.58A {Homo sapiens} SCOP: d.92.1.9 PDB: 1r54_A* Back     alignment and structure
>2dw0_A Catrocollastatin; apoptotic toxin, SVMP, metalloproteinase, apoptosis, toxin; HET: NAG BMA MAN GM6; 2.15A {Crotalus atrox} PDB: 2dw1_A* 2dw2_A* 3dsl_A* 3hdb_A* Back     alignment and structure
>1atl_A Atrolysin C; metalloendopeptidase, hydrolase-hydrolase inhibitor complex; HET: 0QI; 1.80A {Crotalus atrox} SCOP: d.92.1.9 PDB: 1htd_A 1dth_A* 3aig_A* 2aig_P* 4aig_A* 1iag_A Back     alignment and structure
>2e3x_A Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Back     alignment and structure
>2ero_A VAP-1, vascular apoptosis-inducing protein 1; metalloprotease, disintegrin, calcium-binding, ADAM, SVMP, M protein, toxin; HET: NAG; 2.50A {Crotalus atrox} PDB: 2erp_A* 2erq_A* Back     alignment and structure
>3b8z_A Protein adamts-5; alpha/beta, hydrolase; HET: 294; 1.40A {Homo sapiens} PDB: 3hyg_A* 3hy9_A* 3hy7_A* 3ljt_A* Back     alignment and structure
>4dd8_A Disintegrin and metalloproteinase domain-containi 8; batimastat, inflammation, alpha/beta motif, metalloproteinas allergic asthma, tumorigenesis; HET: BAT; 2.10A {Homo sapiens} Back     alignment and structure
>2ddf_A ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapiens} PDB: 2fv5_A* 3l0v_A* 3kme_A* 3l0t_A* 3kmc_A* 3le9_A* 3lea_A* 3lgp_A* 3o64_A* 3ewj_A* 3edz_A* 3e8r_A* 2fv9_A* 1zxc_A* 2oi0_A* 3b92_A* 2a8h_A* 1bkc_A* 3cki_A 1bkc_I* ... Back     alignment and structure
>2v4b_A Adamts-1; zymogen, protease, hydrolase, metalloprotease, heparin-binding, metalloproteinase, metzincin, glycoprotein metal-binding; 2.00A {Homo sapiens} PDB: 2jih_A 3q2g_A* 3q2h_A* Back     alignment and structure
>2rjp_A Adamts-4; metalloprotease domain, aggrecanase, cleavage on PAIR of basic residues, extracellular matrix, glycoprotein, hydrolase, metal-binding; HET: 886; 2.80A {Homo sapiens} PDB: 3b2z_A Back     alignment and structure
>2i47_A ADAM 17; TACE-inhibitor complex, hydrolase; HET: INN KGY; 1.90A {Homo sapiens} SCOP: d.92.1.10 PDB: 3g42_A* Back     alignment and structure
>2rjq_A Adamts-5; metalloprotease domain, aggrecanase, cleavage on PAIR of BAS residues, extracellular matrix, glycoprotein, hydrolase, ME binding; HET: NAG BAT; 2.60A {Homo sapiens} Back     alignment and structure
>3k7n_A K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A {Naja atra} Back     alignment and structure
>3k7l_A Atragin; SVMP, metalloprotease, hydrolase; HET: NAG; 2.50A {Naja atra} Back     alignment and structure
>1lml_A Leishmanolysin; metalloprotease, glycoprotein; 1.86A {Leishmania major} SCOP: d.92.1.3 Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Back     alignment and structure
>1lbu_A Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus} SCOP: a.20.1.1 d.65.1.1 Back     alignment and structure
>3ujz_A Metalloprotease STCE; mucin-type glycoprotein, hydrolase; 2.50A {Escherichia coli} Back     alignment and structure
>4fet_B Spore cortex-lytic enzyme prepeptide; transglycosylase, cortex hydrolase domain, sodium ION, seMet hydrolase; 1.91A {Bacillus anthracis} Back     alignment and structure
>3bkh_A Phikz144, lytic transglycosylase; bacteriophage, endolysin, peptidoglycan, cell WALL degradation, lysozyme, hydrolase; 2.50A {Pseudomonas phage phikz} PDB: 3bkv_A* Back     alignment and structure
>3cqb_A Probable protease HTPX homolog; heat shock protein HTPX domain, PSI-2, protein structure INI structural genomics; HET: MSE; 1.86A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3e11_A Predicted zincin-like metalloprotease; DUF1025 family protein, zincin-like fold, conserved matrix metalloprotease motif; 1.80A {Acidothermus cellulolyticus 11B} SCOP: d.92.1.17 Back     alignment and structure
>3p1v_A Metallo-endopeptidase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.93A {Bacteroides ovatus atcc 8483} PDB: 4df9_A* Back     alignment and structure
>3c37_A Peptidase, M48 family; Q74D82, GSR143A, structural genomics, protein structure initiative, northeast structural genomics consortium; 1.70A {Geobacter sulfurreducens pca} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 222
d1mmqa_166 d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sap 2e-36
d2ovxa1159 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human 6e-35
d1hy7a_168 d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo 1e-33
d1hv5a_162 d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus 2e-33
d1i76a_163 d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Hum 8e-33
d1xuca1169 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Huma 3e-32
d1hfca_157 d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Hum 2e-31
d1y93a1158 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) 2e-30
d1qiba_161 d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) 4e-29
d1rm8a_169 d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16 8e-28
d1bqqm_174 d.92.1.11 (M:) Membrane-type matrix metalloprotein 5e-25
d1k7ia2241 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrys 7e-20
d1kapp2246 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas ae 4e-16
d1sata2243 d.92.1.6 (A:4-246) Metalloprotease {Serratia marce 4e-16
d1g9ka2242 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp 1e-11
d1l6ja177 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (H 6e-11
d1eaka176 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (H 7e-11
d1su3a167 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) 2e-10
d1slma165 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (H 2e-10
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Matrix metalloproteases, catalytic domain
domain: Matrilysin (MMP-7)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  123 bits (310), Expect = 2e-36
 Identities = 59/168 (35%), Positives = 79/168 (47%), Gaps = 13/168 (7%)

Query: 61  YEFFPGRPRWPPSNSHLTYAFLPGTP----AEAINAVGRAFQTWAAISHFKFSQTQDYTN 116
           Y  FP  P+W   +  +TY  +  T           V +A   W       F +   +  
Sbjct: 1   YSLFPNSPKWT--SKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKV-VWGT 57

Query: 117 ANLKISFQRGWHGDSSPFDGRGGTIAHAAPP---RGGIFDYDADEQWAVGARPGAFDLET 173
           A++ I F RG HGDS PFDG G T+AHA  P    GG   +D DE+W  G+  G      
Sbjct: 58  ADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGIN-FLY 116

Query: 174 VALHEIGHLLGLDHSLVEGAIMYAYIDPGATKG--LHTDDVQGIRALY 219
            A HE+GH LG+ HS    A+MY     G  +   L  DD++GI+ LY
Sbjct: 117 AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLY 164
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Length = 162 Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Length = 158 Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Length = 241 Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Length = 246 Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Length = 243 Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Length = 242 Back     information, alignment and structure
>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 65 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d1hv5a_162 Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxI 100.0
d1mmqa_166 Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9 100.0
d1xuca1169 Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxI 100.0
d1i76a_163 Neutrophil collagenase (MMP-8) {Human (Homo sapien 100.0
d1hy7a_168 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 100.0
d1hfca_157 Fibroblast collagenase (MMP-1) {Human (Homo sapien 100.0
d2ovxa1159 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 100.0
d1qiba_161 Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1y93a1158 Macrophage elastase (MMP-12) {Human (Homo sapiens) 100.0
d1rm8a_169 Matrix metalloproteinase-16 (MMP-16) {Human (Homo 100.0
d1kapp2246 Metalloprotease {Pseudomonas aeruginosa [TaxId: 28 99.98
d1k7ia2241 Metalloprotease {Erwinia chrysanthemi [TaxId: 556] 99.98
d1bqqm_174 Membrane-type matrix metalloproteinase (CDMT1-MMP) 99.98
d1sata2243 Metalloprotease {Serratia marcescens [TaxId: 615]} 99.97
d1g9ka2242 Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId 99.95
d1su3a167 Fibroblast collagenase (MMP-1) {Human (Homo sapien 99.75
d1slma165 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 99.75
d1eaka176 Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 99.7
d1asta_200 Astacin {European fresh water crayfish (Astacus as 99.7
d1l6ja177 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 99.7
d1c7ka_132 Zinc protease {Streptomyces caespitosus [TaxId: 53 99.08
d1bswa_197 Snake venom metalloprotease {Five-pace snake (Agki 97.71
d1quaa_197 Snake venom metalloprotease {Chinese five-pace sna 97.65
d1kufa_201 Snake venom metalloprotease {Taiwan habu (Trimeres 97.65
d1nd1a_202 Snake venom metalloprotease {Terciopelo (Bothrops 97.54
d1atla_200 Snake venom metalloprotease {Western diamonback ra 97.52
d2i47a1254 TNF-alpha converting enzyme, TACE, catalytic domai 97.45
d1r55a_203 ADAM33 {Human (Homo sapiens) [TaxId: 9606]} 97.41
d1lbua183 Zn2+ DD-carboxypeptidase, N-terminal domain {Strep 96.37
d1lmla_ 475 Leishmanolysin {Leishmania major [TaxId: 5664]} 95.79
d3e11a1113 Uncharacterized protein Acel_2062 {Acidothermus ce 89.66
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Matrix metalloproteases, catalytic domain
domain: Stromelysin-3 (MMP-11)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=6.5e-40  Score=257.12  Aligned_cols=154  Identities=37%  Similarity=0.696  Sum_probs=136.2

Q ss_pred             eeeCCCCCCCCCCCceeEEEecCCC----hHHHHHHHHHHHHHHHhcccceEEEecCCCCceEEEEEeecCCCCCCCCCC
Q 039411           61 YEFFPGRPRWPPSNSHLTYAFLPGT----PAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLKISFQRGWHGDSSPFDG  136 (222)
Q Consensus        61 y~~~~~~~~W~~~~~~lty~~~~~~----~~~~~~~i~~A~~~W~~~~~l~F~ev~~~~~adI~I~f~~~~~gd~~~f~g  136 (222)
                      |++  .+.||+  +++|||+|.+.+    +.+++++|++||+.|+++++|+|+|+.+. .+||+|.|....+.++.++++
T Consensus         2 y~l--~G~kW~--~~~iTY~~~~~~~~~~~~~~~~~i~~A~~~W~~v~~i~F~ev~~~-~~di~i~~~~~~~~~~~~~~~   76 (162)
T d1hv5a_           2 FVL--SGGRWE--KTDLTYRILRFPWQLVREQVRQTVAEALQVWSEVTPLTFTEVHEG-RADIMIDFARYWHGDNLPFDG   76 (162)
T ss_dssp             EEE--ETTEEE--ECEEEEEECSCCTTSCHHHHHHHHHHHHHHHHTTSSCEEEECSSS-BCSEEEEEECSCSSSSCCCCS
T ss_pred             ccc--cCCcCC--CCeEEEEEEecCCCCCHHHHHHHHHHHHHHHhccCCceEEEeecC-CCceEEEEeccccCCcccccC
Confidence            556  567999  999999997643    34788999999999999999999999864 799999999888888888888


Q ss_pred             CCCeeeeecCC---CCceeeecCCCCcccCCCCCccchhHHHHHhhhhhcCCCCCCCCCCceeeeeCCCCCCCCCHhhHH
Q 039411          137 RGGTIAHAAPP---RGGIFDYDADEQWAVGARPGAFDLETVALHEIGHLLGLDHSLVEGAIMYAYIDPGATKGLHTDDVQ  213 (222)
Q Consensus       137 ~g~~la~a~~P---~~g~i~fd~~~~w~~~~~~~~~~~~~va~HEiGHaLGL~Hs~~~~siM~p~~~~~~~~~l~~~Di~  213 (222)
                      .+++++++++|   ..++|.|+..+.|+.... .+.+++.|++|||||+|||.|++++++||+|+|.++....|+.+||+
T Consensus        77 ~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~-~g~~~~~v~~HEiGHaLGL~H~~~~~svM~p~~~~~~~~~l~~~Di~  155 (162)
T d1hv5a_          77 PGGILAHAFFPKTHREGDVHFDYDETWTIGDN-QGTDLLQVAAHEFGHVLGLQHTTAAKALMSPFYTFRYPLSLSPDDRR  155 (162)
T ss_dssp             SSSCCEEEECCTTSSSEEEEEETTSCEESSCS-SSEEHHHHHHHHHHHHTTCCCCSCTTSTTCSSCCCCSSCCCCHHHHH
T ss_pred             CCceeeeeecCCCccccceeecchhccccccc-cCcchhhhhhhhhhhhccCCCCCCCCccccCcccCCCCCCCCHHHHH
Confidence            99999999998   457899999999987654 35789999999999999999999999999999987667799999999


Q ss_pred             HHHHHhc
Q 039411          214 GIRALYN  220 (222)
Q Consensus       214 ~iq~LYg  220 (222)
                      +||+|||
T Consensus       156 ~i~~LYG  162 (162)
T d1hv5a_         156 GIQHLYG  162 (162)
T ss_dssp             HHHHHCC
T ss_pred             HHHHhcC
Confidence            9999998
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Back     information, alignment and structure
>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1asta_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]} Back     information, alignment and structure
>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7ka_ d.92.1.1 (A:) Zinc protease {Streptomyces caespitosus [TaxId: 53502]} Back     information, alignment and structure
>d1bswa_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId: 36307]} Back     information, alignment and structure
>d1quaa_ d.92.1.9 (A:) Snake venom metalloprotease {Chinese five-pace snake (Agkistrodon acutus), acutolysin C [TaxId: 36307]} Back     information, alignment and structure
>d1kufa_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId: 103944]} Back     information, alignment and structure
>d1nd1a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1 [TaxId: 8722]} Back     information, alignment and structure
>d1atla_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]} Back     information, alignment and structure
>d2i47a1 d.92.1.10 (A:220-473) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r55a_ d.92.1.9 (A:) ADAM33 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lbua1 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-terminal domain {Streptomyces albus G [TaxId: 1962]} Back     information, alignment and structure
>d1lmla_ d.92.1.3 (A:) Leishmanolysin {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3e11a1 d.92.1.17 (A:1-113) Uncharacterized protein Acel_2062 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure