Citrus Sinensis ID: 039489

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MVPPAGTPPPNPQQIQQFLSSVLSQRGPSALPYAEDTKWLIRQHLLTLISTFPSLDPKTATFTHNDGRSVNLLQADGTVPMPFQGVTYNIPVIIWLMESYPRHPPCVYVNPTRDMIIKRPHPHVTPSGLVSIPYLQNWIYPSSNLVDLVRELSACFSREPPLYSQRRPSPSPNSSPNPNPSHNQSNPAVMSNYGPSPSPQARPQPARPFPPSPYGGRPQPQPQTEDQTEVFKRNAVNKLVEMVHADITGMRKAREVEVEGLFSTQALLRRREEEIDRGLKELQDEREGLEQQLQIVLMNSDILE
cccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccEEEccccccEEEEEEEEEEEEcccccccccEEEEEEcccccccccEEEEccccccccccccccccccccEEcccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
****************QFLSSVLSQRGPSALPYAEDTKWLIRQHLLTLISTFPSLDPKTATFTHNDGRSVNLLQADGTVPMPFQGVTYNIPVIIWLMESYPRHPPCVYVNPTRDMIIKRPHPHVTPSGLVSIPYLQNWIYPSSNLVDLVRELSACFSREPPL**********************************************************************RNAVNKLVEMVHADITGMRKAREVEVEGLFSTQAL***************************IVLM******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVPPAGTPPPNPQQIQQFLSSVLSQRGPSALPYAEDTKWLIRQHLLTLISTFPSLDPKTATFTHNDGRSVNLLQADGTVPMPFQGVTYNIPVIIWLMESYPRHPPCVYVNPTRDMIIKRPHPHVTPSGLVSIPYLQNWIYPSSNLVDLVRELSACFSREPPLYSQRRPSPSPNSSPNPNPSHNQSNPAVMSNYGPSPSPQARPQPARPFPPSPYGGRPQPQPQTEDQTEVFKRNAVNKLVEMVHADITGMRKAREVEVEGLFSTQALLRRRxxxxxxxxxxxxxxxxxxxxxxxxxxxxSDILE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein ELC Component of the ESCRT-I complex (endosomal sorting complex required for transport I), a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs) Mediates the association to the ESCRT-0 complex. May control nuclear division through the microtubule cytoskeleton.probableQ9LHG8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3R3Q, chain A
Confidence level:very confident
Coverage over the Query: 10-161
View the alignment between query and template
View the model in PyMOL
Template: 3IV1, chain A
Confidence level:confident
Coverage over the Query: 224-294
View the alignment between query and template
View the model in PyMOL