Citrus Sinensis ID: 039504

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
NCLHFTVLSEADEDQIPEVAIEPDDPVALPFSSGTTGLPKGVVLTHKSLITSVAQQVDGENPNLYLTNGDVVLCVLPLFHIYSLNSVLLCSLRAGAGVLLMQKFEIGALLELIQRHRVSVAAVVPPLVLALAKNPMVADYDLSSIRVVLSGAAPLGKELEDALRSRVPQAILGQGYGMTEAGPVLSMCLGFAKQPFPTKSGSCGTVVRNAELKVIDPETGASLPHNQPGEICIRGPQIMK
cccccHHHHccccccccccccccccEEEEEccccccccccCEEEccHHHHHHHHHHHcccccccccccccEEEEEccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccccEEEccHHHHHHHHccccccccccccccccEEccccccHHHHHHHHHHccccEEEEccccccccccHHccccccccccccccccccccccccEEEEEcccccccccccccccEEEEcccccc
NCLHFTVLSEADEDQIPEVAIEPDDPVALPFSSGTTGLPKGVVLTHKSLITSVAQQVDGENPNLYLTNGDVVLCVLPLFHIYSLNSVLLCSLRAGAGVLLMQKFEIGALLELIQRHRVSVAAVVPPLVLALAKNPMVADYDLSSIRVVLSGAAPLGKELEDALRSRVPQAILGQGYGMTEAGPVLSMCLGFAKQPFPTKSGSCGTVVRNAELKVIDPETGASLPHNQPGEICIRGPQIMK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NCLHFTVLSEADEDQIPEVAIEPDDPVALPFSSGTTGLPKGVVLTHKSLITSVAQQVDGENPNLYLTNGDVVLCVLPLFHIYSLNSVLLCSLRAGAGVLLMQKFEIGALLELIQRHRVSVAAVVPPLVLALAKNPMVADYDLSSIRVVLSGAAPLGKELEDALRSRVPQAILGQGYGMTEAGPVLSMCLGFAKQPFPTKSGSCGTVVRNAELKVIDPETGASLPHNQPGEICIRGPQIMK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable 4-coumarate--CoA ligase 2 probableQ42982
4-coumarate--CoA ligase 3 Produces CoA thioesters of a variety of hydroxy- and methoxy-substituted cinnamic acids, which are used to synthesize several phenylpropanoid-derived compounds, including anthocyanins, flavonoids, isoflavonoids, coumarins, lignin, suberin and wall-bound phenolics.probableQ9S777
4-coumarate--CoA ligase 2 probableP31687

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TSY, chain A
Confidence level:very confident
Coverage over the Query: 17-240
View the alignment between query and template
View the model in PyMOL