Citrus Sinensis ID: 039524

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-

MGLKSLPKQFHQPLEERFSEKKILDQVSIPLIDMSNWESPEVAKSICDAAENWGFFQIVNHGVPLEVLERVKEATHRFFALPAEEKRKYSKENSPTNKVRLGSSFVPLVEKALEWKDFLSLFYGSEEETSAFWPPVCKDETLEYMKSSEVLIRRLMHVLVKGLNVKRIDEIREPMLLGSRRVNLNYYPMCPNPELTVGVGRHSDISTFTILLQDDIGGLHVRKDSGNDWIHVAPISGSLIINIGDALQIMSNGRYKSIEHCVIANGSQNRISVPLFVNPKPEAILCPFPEVLANGEKPLYKPVLCADYSRHFYTKAHDGKKTIDFAKIGDF

ccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHccccccccCEEEccccccccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccCEEEcccccccccccccccccccccccccEEEEccccccEEEEEcccccEEEcccccccEEEEEccEEEEEEcccccccccEEEEcccccEEEEEEECccccccEECccccccccccccccccccHHHHHHHHHHccccccccccccccccc

MGLKSLPKQFHQPLE*******ILDQVSIPLIDMSNWESPEVAKSICDAAENWGFFQIVNHGVPLEVLERVKEATHRFFALPAEEKRKYS**NS*TNKVRLGSSFVPLVEKALEWKDFLSLFYGSEEETSAFWPPVCKDETLEYMKSSEVLIRRLMHVLVKGLNVKRIDEIREPMLLGSRRVNLNYYPMCPNPELTVGVGRHSDISTFTILLQDDIGGLHVRKDSGNDWIHVAPISGSLIINIGDALQIMSNGRYKSIEHCVIANGSQNRISVPLFVNPKPEAILCPFPEVLANGEKPLYKPVLCADYSRHFYTKAHDGKKTIDFAKIGD*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Feruloyl CoA ortho-hydroxylase 1	2-oxoglutarate (OG)- and Fe(II)-dependent dioxygenase (2OGD)involved in scopoletin biosynthesis. Converts feruloyl CoA into 6'-hydroxyferuloyl CoA but has no activity with ferulic acid, feruloylquinic acid, caffeic acid, caffeoyl CoA, p-coumaric acid, cinnamic acid, cinnamoyl CoA or benzoyl CoA.	probable	Q9LHN8

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W9Y, chain A
Confidence level:very confident
Coverage over the Query: 27-325
View the alignment between query and template
View the model in PyMOL

Template: 1GP6, chain A
Confidence level:very confident
Coverage over the Query: 1-321
View the alignment between query and template
View the model in PyMOL