Citrus Sinensis ID: 039568

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
LTVAEKDVATLGPILDHVAATNLSIIQKNLWDPDVRRALLFNDRVEEGDATWQVIRALSQKLDRSYRRSEVSGQ
ccccccccccHHHHHHHcccHHHHHHHHHccccHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccc
*TVAEKDVATLGPILDHVAATNLSIIQKNLWDPDVRRALLFNDRVEEGDATWQVIRALSQ**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LTVAEKDVATLGPILDHVAATNLSIIQKNLWDPDVRRALLFNDRVEEGDATWQVIRALSQKLDRSYRRSEVSGQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable glucuronoxylan glucuronosyltransferase IRX7 Involved in the synthesis of the hemicellulose glucuronoxylan, a major component of secondary cell walls. Probably involved in the synthesis of the glycosyl sequence at the glucuronoxylan reducing end.probableQ9ZUV3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted