Citrus Sinensis ID: 039589

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------
MSSSNSPCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELATNLREDAVNSLAYEAEARLRDPVYGCVGLISILQHRLKQVQSDLYSAKKELATYIGPQAMMPMLQAQAFMPQQHLGNPSSSTVIQHGMVPMMGIPTGSSHSGQLVIRDPQHQHQHNQQQQQMFEAQQLAAAVAAKEQQEMLRSYEQQQELVRFNSGFDAPTGFNNQMSGGTMSPSLALGGFDNSYQIQAQQQPAEHHHHHATAHPLQAQLLQQQPPPPPQTQQQQKSPSEEGRSIGGPSC
cccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHcccccccccccccccccHHHHccccccccccccccccccccccccccccccc
*****SP*AACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELATNLREDAVNSLAYEAEARLRDPVYGCVGLISILQHRLKQVQSDLYSAKKELATYIGPQAM************************************************************************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSNSPCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELATNLREDAVNSLAYEAEARLRDPVYGCVGLISILQHRLKQVQSDLYSAKKELATYIGPQAMMPMLQAQAFMPQQHLGNPSSSTVIQHGMVPMMGIPTGSSHSGQLVIRDPQHQHQHNQQQQQMFEAQQLAAAVAAKEQQEMLRSYEQQQELVRFNSGFDAPTGFNNQMSGGTMSPSLALGGFDNSYQIQAQQQPAEHHHHHATAHPLQAQLLQQQPPPPPQTQQQQKSPSEEGRSIGGPSC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
LOB domain-containing protein 6 Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation.probableQ8LQH4
LOB domain-containing protein 36 Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP.probableQ9FKZ3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted