Citrus Sinensis ID: 039624

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460------

MAEPVQQQDILPWLKTLPVAPEFHPTLAEFQDPIAYIFKIEKEASQYGICKIVPPVPPPPKKTAITFLNRSLAQRAAATGGATSSSGPTFTTRQQQIGFCPRKPRPVQKPVWQSGEYYTFQEFETKAKNFEKSYLKKCGNKKAALSALEIESLYWKASVDKPFSVEYANDMPGSAFVPVRKIREAVGEGVTVGETPWNMRGVSRAKGSLLRFMKEEIPGVTSPMVYIAMLFSWFAWHAEDHDLHSLNYLHMGASKTWYGVPMEAANAFEEVVRVHGYGEEINPLVTFATLGEKTTMISPEVFVGAGVPCCRLVQNAGEFVVTFPRAYHMGFSHGFNCGEAANIATPEWLNIAKDAAIRRASINYPPMVSHFQLLYDLAIAMHSSIPVAVSAKPRSSRLKDKNKDEGETLVKELFVQDVAQNNELLHVLGQGSPIVLLPQSSSGALGANPWIPLGLCSYREAIKSSG

cccccccccccccccccccccCCcccHHHHccHHHHHHHHHHHHHHcccEEEccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccHHHHHHHHHccccEEccccccccccccccccccEECccHHHHHHHHHHHHHHcccccccccHHHHHHccccccccHHHHHHccccccccccccccEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccccccccccccccccccccccccccccc

**********LPWLKTLPVAPEFHPTLAEFQDPIAYIFKIEKEASQYGICKIVPPVPPPPKKTAITFLNRSLAQRAAATGGATSSSGPTFTTRQQQIGFCPRKPRPVQKPVWQSGEYYTFQEFETKAKNFEKSYLKKCGNKKAALSALEIESLYWKASVDKPFSVEYANDMPGSAFV************VTVGETPWNMRGVSRAKGSLLRFMKEEIPGVTSPMVYIAMLFSWFAWHAEDHDLHSLNYLHMGASKTWYGVPMEAANAFEEVVRVHGYGEEINPLVTFATLGEKTTMISPEVFVGAGVPCCRLVQNAGEFVVTFPRAYHMGFSHGFNCGEAANIATPEWLNIAKDAAIRRASINYPPMVSHFQLLYDLAIAMHSSIPVAVSAKPRSSR***********LVKELFVQDVAQNNELLHVLGQGSPIVLLPQSSSGALGANPWIPLGLCS*********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Lysine-specific demethylase REF6	Histone demethylase that demethylates 'Lys-27' (H3K27me) of histone H3. Demethylates both tri- (H3K27me3) and di-methylated (H3K27me2) H3K27me. Demethylates also H3K4me3/2 and H3K36me3/2 in an in vitro assay. Involved in the transcriptional regulation of hundreds of genes regulating developmental patterning and responses to various stimuli. Involved in the regulation of flowering time by repressing FLOWERING LOCUS C (FLC) expression.	probable	Q9STM3

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DXT, chain A
Confidence level:very confident
Coverage over the Query: 16-69,87-179,194-375
View the alignment between query and template
View the model in PyMOL

Template: 3OPT, chain A
Confidence level:very confident
Coverage over the Query: 18-103,116-179,194-203,222-346
View the alignment between query and template
View the model in PyMOL