Citrus Sinensis ID: 039635


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58
MEQSEKLHMHVHQHPFSCGSRPERCFACLGEISGNFYICGHCDSDSPLFHQSCAELPQLLQTNFHPHCRFRFKEESDVFSFKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFACAATLIEHYRVQEHIIEHFSHRHPLIRLEVDEEWCRICRNNILGPSYGCLPCKFYIHNSCSELPQQVLHPFHAHHSLKLQNTFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDCISVKPKIRYQGQEHLLVLMKSGSGTTTCQACSFDTKPGAFFVRCVECDFKFHVQCGPASPPPIVEHIHHGHSLTLTLPTDSFVKDKFDLFYCDACKEEIDPQNPFCCCIECGYYIHWRCTVIEVPLNDTLVHFDHNHFLLPLENGTNDDVPCYACGKVLIQDQNHPTYGCDPCRIYLHKTCAQMPRQIQHVLHRHPLTVTTNDGERGRTCDACQKYLHGHIYKCDSCDFVLDFDCATLQSRVLNHTAKCRKYKFAISEASFQDCLKCNFTLHLMLSPLPLTIEHMSHHQHSLTLMDKHADGNYGTQICDVCEEERDQQERVYYCEECDYIADFMCVIEVTKPTDYFLEKSY
ccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEcccccccccccEECccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEcccccccccHHHccccccccccccccEEEEEEccccccccccccccccccccEEEccccccEEcccccccccccEEEcccccccccEEcccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccHHHHccccccccccccccEEEECccccccccccccccccccEEEEEccccccccccccccccccccccccccccEEccccccEEcccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccc
*********HVHQHPFSCGSRPERCFACLGEISGNFYICGHCDSDSPLFHQSCAELPQLLQTNFHPHCRFRFKEESDVFSFKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFACAATLIEHYRVQEHIIEHFSHRHPLIRLEVDEEWCRICRNNILGPSYGCLPCKFYIHNSCSELPQQVLHPFHAHHSLKLQNTFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDCISVKPKIRYQGQEHLLVLMKSGSGTTTCQACSFDTKPGAFFVRCVECDFKFHVQCGPASPPPIVEHIHHGHSLTLTLPTDSFVKDKFDLFYCDACKEEIDPQNPFCCCIECGYYIHWRCTVIEVPLNDTLVHFDHNHFLLPLENGTNDDVPCYACGKVLIQDQNHPTYGCDPCRIYLHKTCAQMPRQIQHVLHRHPLTVTTNDGERGRTCDACQKYLHGHIYKCDSCDFVLDFDCATLQSRVLNHTAKCRKYKFAISEASFQDCLKCNFTLHLMLSPLPLTIEHMSHHQHSLTLMDKHADGNYGTQICDVCEEERDQQERVYYCEECDYIADFMCVIEVTKPTDYFL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQSEKLHMHVHQHPFSCGSRPERCFACLGEISGNFYICGHCDSDSPLFHQSCAELPQLLQTNFHPHCRFRFKEESDVFSFKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFACAATLIEHYRVQEHIIEHFSHRHPLIRLEVDEEWCRICRNNILGPSYGCLPCKFYIHNSCSELPQQVLHPFHAHHSLKLQNTFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDCISVKPKIRYQGQEHLLVLMKSGSGTTTCQACSFDTKPGAFFVRCVECDFKFHVQCGPASPPPIVEHIHHGHSLTLTLPTDSFVKDKFDLFYCDACKEEIDPQNPFCCCIECGYYIHWRCTVIEVPLNDTLVHFDHNHFLLPLENGTNDDVPCYACGKVLIQDQNHPTYGCDPCRIYLHKTCAQMPRQIQHVLHRHPLTVTTNDGERGRTCDACQKYLHGHIYKCDSCDFVLDFDCATLQSRVLNHTAKCRKYKFAISEASFQDCLKCNFTLHLMLSPLPLTIEHMSHHQHSLTLMDKHADGNYGTQICDVCEEERDQQERVYYCEECDYIADFMCVIEVTKPTDYFLEKSY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V5N, chain A
Confidence level:very confident
Coverage over the Query: 401-469
View the alignment between query and template
View the model in PyMOL
Template: 1V5N, chain A
Confidence level:very confident
Coverage over the Query: 48-119
View the alignment between query and template
View the model in PyMOL
Template: 3PFQ, chain A
Confidence level:confident
Coverage over the Query: 67-119
View the alignment between query and template
View the model in PyMOL
Template: 3PFQ, chain A
Confidence level:confident
Coverage over the Query: 135-176
View the alignment between query and template
View the model in PyMOL
Template: 2YSM, chain A
Confidence level:probable
Coverage over the Query: 198-291,306-329
View the alignment between query and template
View the model in PyMOL
Template: 3V43, chain A
Confidence level:probable
Coverage over the Query: 487-576
View the alignment between query and template
View the model in PyMOL
Template: 2FC7, chain A
Confidence level:probable
Coverage over the Query: 377-431
View the alignment between query and template
View the model in PyMOL
Template: 1RFH, chain A
Confidence level:probable
Coverage over the Query: 316-350
View the alignment between query and template
View the model in PyMOL