Citrus Sinensis ID: 039635


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58
MEQSEKLHMHVHQHPFSCGSRPERCFACLGEISGNFYICGHCDSDSPLFHQSCAELPQLLQTNFHPHCRFRFKEESDVFSFKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFACAATLIEHYRVQEHIIEHFSHRHPLIRLEVDEEWCRICRNNILGPSYGCLPCKFYIHNSCSELPQQVLHPFHAHHSLKLQNTFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDCISVKPKIRYQGQEHLLVLMKSGSGTTTCQACSFDTKPGAFFVRCVECDFKFHVQCGPASPPPIVEHIHHGHSLTLTLPTDSFVKDKFDLFYCDACKEEIDPQNPFCCCIECGYYIHWRCTVIEVPLNDTLVHFDHNHFLLPLENGTNDDVPCYACGKVLIQDQNHPTYGCDPCRIYLHKTCAQMPRQIQHVLHRHPLTVTTNDGERGRTCDACQKYLHGHIYKCDSCDFVLDFDCATLQSRVLNHTAKCRKYKFAISEASFQDCLKCNFTLHLMLSPLPLTIEHMSHHQHSLTLMDKHADGNYGTQICDVCEEERDQQERVYYCEECDYIADFMCVIEVTKPTDYFLEKSY
ccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEcccccccccccEEEccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEcccccccccHHHHcccccccccccccEEEEEEccccccccccccccccccccEEEccccccEEcccccccccccEEEcccccccccEEcccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccHHHHccccccccccccccEEEEEccccccccccccccccccEEEEEccccccccccccccccccccccccccccEEccccccEEcccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccc
ccccccccccccccccEEcccccccccccccccccEEEEEccccccEEEEHHHcccccEEEccccccccEEEEcccccccccccccEEEcccccccccEEEEEccEEEEEEHHHccccccccccccccccccccccccEcccccccccccccccccccEEEEccccEEEEHHHccccccEEccccccccEEEEcccccccEEccccccccccEEEEEcccEEEEEHHHcccccccccccccccEEEccccccccEEcccccccccccEEEEEEcccEEEEHHHcccccccEEEcccccccEEEEcccccccccccccEEEcEEEccccccccEEEEcccEEEEEEEEEEcccccccEEEccccccccEEEccccccccccccccccccccccccEEEEEEEEEEEEHHHcccccccccccccccEEEEcccccccEEEEccccccccEEEEEccccEEEEEEEccccccccccccccccEEEEcccccEEEEEEEEEEEEccccccccEEEccccccccEEEEccccccccccEEEEHEccccccccEEEEcccccEEEEEEEEEEEcccccEEEcccc
meqseklhmhvhqhpfscgsrperCFACLgeisgnfyicghcdsdsplfhqscaelpqllqtnfhphcrfrfkeesdvfsfkrtlefgcdfcdqshkgykyccdlCNFQIGFACAATLIEHYRVQEHIIEhfshrhplirlevDEEWCRIcrnnilgpsygclpckfyihnscselpqqvlhpfhahhslkLQNTFRGLLYCDACDSMimsakhyrcdecdfdlhldcisvkpkiryQGQEHLLVLMKsgsgtttcqacsfdtkpgaffVRCVecdfkfhvqcgpaspppivehihhghsltltlptdsfvkdkfdlfycdackeeidpqnpfccciecgyyihwRCTVievplndtlvhfdhnhfllplengtnddvpcyacgkvliqdqnhptygcdpcriylhktCAQMPRQIQhvlhrhpltvttndgergrtcDACQKylhghiykcdscdfvldfdcATLQSRVLNHTAKCRKYKFAISEASFQDCLkcnftlhlmlsplpltiehmshhqhsltlmdkhadgnygtqicdvCEEERDQQERVYYCEECDYIADFMCVIEvtkptdyfleksy
meqseklhmhvhqhpfscgsrPERCFACLGEISGNFYICGHCDSDSPLFHQSCAELPQLLQTNFHPHCRFRFKEESDVFSFKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFACAATLIEHYRVQEHIIEHFSHRHPLIRLEVDEEWCRICRNNILGPSYGCLPCKFYIHNSCSELPQQVLHPFHAHHSLKLQNTFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDCISVKPKIRYQGQEHLLVLMKSGSGTTTCQACSFDTKPGAFFVRCVECDFKFHVQCGPASPPPIVEHIHHGHSLTLTLPTDSFVKDKFDLFYCDACKEEIDPQNPFCCCIECGYYIHWRCTVIEVPLNDTLVHFDHNHFLLPLENGTNDDVPCYACGKVLIQDQNHPTYGCDPCRIYLHKTCAQMPRQIQHVLHRHPltvttndgergrTCDACQKYLHGHIYKCDSCDFVLDFDCATLQSRVLNHTAKCRKYKFAISEASFQDCLKCNFTLHLMLSPLPLTIEHMSHHQHSLTLMDKHADGNYGTQICDVCEEERDQQERVYYCEECDYIADFMCVIEVTKptdyfleksy
MEQSEKLHMHVHQHPFSCGSRPERCFACLGEISGNFYICGHCDSDSPLFHQSCAELPQLLQTNFHPHCRFRFKEESDVFSFKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFACAATLIEHYRVQEHIIEHFSHRHPLIRLEVDEEWCRICRNNILGPSYGCLPCKFYIHNSCSELPQQVLHPFHAHHSLKLQNTFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDCISVKPKIRYQGQEHLLVLMKSGSGTTTCQACSFDTKPGAFFVRCVECDFKFHVQCGPASPPPIVEHIHHGHSLTLTLPTDSFVKDKFDLFYCDACKEEIDPQNPFCCCIECGYYIHWRCTVIEVPLNDTLVHFDHNHFLLPLENGTNDDVPCYACGKVLIQDQNHPTYGCDPCRIYLHKTCAQMPRQIQHVLHRHPLTVTTNDGERGRTCDACQKYLHGHIYKCDSCDFVLDFDCATLQSRVLNHTAKCRKYKFAISEASFQDCLKCNFTLHLMLSPLPLTIEHMSHHQHSLTLMDKHADGNYGTQICDVCEEERDQQERVYYCEECDYIADFMCVIEVTKPTDYFLEKSY
***************FSCGSRPERCFACLGEISGNFYICGHCDSDSPLFHQSCAELPQLLQTNFHPHCRFRFKEESDVFSFKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFACAATLIEHYRVQEHIIEHFSHRHPLIRLEVDEEWCRICRNNILGPSYGCLPCKFYIHNSCSELPQQVLHPFHAHHSLKLQNTFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDCISVKPKIRYQGQEHLLVLMKSGSGTTTCQACSFDTKPGAFFVRCVECDFKFHVQCGPASPPPIVEHIHHGHSLTLTLPTDSFVKDKFDLFYCDACKEEIDPQNPFCCCIECGYYIHWRCTVIEVPLNDTLVHFDHNHFLLPLENGTNDDVPCYACGKVLIQDQNHPTYGCDPCRIYLHKTCAQMPRQIQHVLHRHPLTVTTNDGERGRTCDACQKYLHGHIYKCDSCDFVLDFDCATLQSRVLNHTAKCRKYKFAISEASFQDCLKCNFTLHLMLSPLPLTIEHMSHHQHSLTLMDKHADGNYGTQICDVCEEERDQQERVYYCEECDYIADFMCVIEVTKPTDYFL****
*********HVHQHPFSCGSRPERCFACLGEISGNFYICGHCDSDSPLFHQSCAELPQLLQTNFHPHCRFRFKEESDVFSFKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFACAATLIEHYRVQEHIIEHFSHRHPLIRLEVDEEWCRICRNNILGPSYGCLPCKFYIHNSCSELPQQVLHPFHAHHSLKLQNTFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDCISVKPKIRYQGQEHLLVLMKSGSGTTTCQACSFDTKPGAFFVRCVECDFKFHVQCGPASPPPIVEHIHHGHSLTLTLPTDSFVKDKFDLFYCDACKEEIDPQNPFCCCIECGYYIHWRCTVIEVPLNDTLVHFDHNHFLLPLENGTNDDVPCYACGKVLIQDQNHPTYGCDPCRIYLHKTCAQMPRQIQHVLHRHPLTVTTNDGERGRTCDACQKYLHGHIYKCDSCDFVLDFDCATLQSRVLNHTAKCRKYKFAISEASFQDCLKCNFTLHLMLSPLPLTIEHMSHHQHSLTLMDKHADGNYGTQICDVCEEERDQQERVYYCEECDYIADFMCVIEVTKPTD**L****
*******************SRPERCFACLGEISGNFYICGHCDSDSPLFHQSCAELPQLLQTNFHPHCRFRFKEESDVFSFKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFACAATLIEHYRVQEHIIEHFSHRHPLIRLEVDEEWCRICRNNILGPSYGCLPCKFYIHNSCSELPQQVLHPFHAHHSLKLQNTFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDCISVKPKIRYQGQEHLLVLMKSGSGTTTCQACSFDTKPGAFFVRCVECDFKFHVQCGPASPPPIVEHIHHGHSLTLTLPTDSFVKDKFDLFYCDACKEEIDPQNPFCCCIECGYYIHWRCTVIEVPLNDTLVHFDHNHFLLPLENGTNDDVPCYACGKVLIQDQNHPTYGCDPCRIYLHKTCAQMPRQIQHVLHRHPLTVTTNDGERGRTCDACQKYLHGHIYKCDSCDFVLDFDCATLQSRVLNHTAKCRKYKFAISEASFQDCLKCNFTLHLMLSPLPLTIEHMSHHQHSLTLMDKHADGNYGTQICDVCEEERDQQERVYYCEECDYIADFMCVIEVTKPTDYFLEKSY
*****KLHMHVHQHPFSCGSRPERCFACLGEISGNFYICGHCDSDSPLFHQSCAELPQLLQTNFHPHCRFRFKEESDVFSFKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFACAATLIEHYRVQEHIIEHFSHRHPLIRLEVDEEWCRICRNNILGPSYGCLPCKFYIHNSCSELPQQVLHPFHAHHSLKLQNTFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDCISVKPKIRYQGQEHLLVLMKSGSGTTTCQACSFDTKPGAFFVRCVECDFKFHVQCGPASPPPIVEHIHHGHSLTLTLPTDSFVKDKFDLFYCDACKEEIDPQNPFCCCIECGYYIHWRCTVIEVPLNDTLVHFDHNHFLLPLENGTNDDVPCYACGKVLIQDQNHPTYGCDPCRIYLHKTCAQMPRQIQHVLHRHPLTVTTNDGERGRTCDACQKYLHGHIYKCDSCDFVLDFDCATLQSRVLNHTAKCRKYKFAISEASFQDCLKCNFTLHLMLSPLPLTIEHMSHHQHSLTLMDKHADGNYGTQICDVCEEERDQQERVYYCEECDYIADFMCVIEVTKPTDYFLEKSY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQSEKLHMHVHQHPFSCGSRPERCFACLGEISGNFYICGHCDSDSPLFHQSCAELPQLLQTNFHPHCRFRFKEESDVFSFKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFACAATLIEHYRVQEHIIEHFSHRHPLIRLEVDEEWCRICRNNILGPSYGCLPCKFYIHNSCSELPQQVLHPFHAHHSLKLQNTFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDCISVKPKIRYQGQEHLLVLMKSGSGTTTCQACSFDTKPGAFFVRCVECDFKFHVQCGPASPPPIVEHIHHGHSLTLTLPTDSFVKDKFDLFYCDACKEEIDPQNPFCCCIECGYYIHWRCTVIEVPLNDTLVHFDHNHFLLPLENGTNDDVPCYACGKVLIQDQNHPTYGCDPCRIYLHKTCAQMPRQIQHVLHRHPLTVTTNDGERGRTCDACQKYLHGHIYKCDSCDFVLDFDCATLQSRVLNHTAKCRKYKFAISEASFQDCLKCNFTLHLMLSPLPLTIEHMSHHQHSLTLMDKHADGNYGTQICDVCEEERDQQERVYYCEECDYIADFMCVIEVTKPTDYFLEKSY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query579
224144591 838 predicted protein [Populus trichocarpa] 0.886 0.612 0.285 2e-41
356572112567 PREDICTED: uncharacterized protein LOC10 0.740 0.756 0.278 5e-36
449460291 1296 PREDICTED: uncharacterized protein LOC10 0.835 0.373 0.285 4e-35
224139892675 predicted protein [Populus trichocarpa] 0.884 0.758 0.271 5e-35
224137826 701 predicted protein [Populus trichocarpa] 0.889 0.734 0.252 4e-33
224139812 697 predicted protein [Populus trichocarpa] 0.879 0.730 0.248 2e-31
15240290652 cysteine/histidine-rich C1 domain-contai 0.913 0.811 0.249 1e-30
4678348669 putative protein [Arabidopsis thaliana] 0.908 0.786 0.253 3e-30
22331691619 cysteine/histidine-rich C1 domain-contai 0.882 0.825 0.258 1e-29
449460297675 PREDICTED: uncharacterized protein LOC10 0.877 0.752 0.249 3e-29
>gi|224144591|ref|XP_002325342.1| predicted protein [Populus trichocarpa] gi|222862217|gb|EEE99723.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  177 bits (448), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 183/640 (28%), Positives = 264/640 (41%), Gaps = 127/640 (19%)

Query: 25  CFACLGEISGNFYICGHCDSDSPLFHQSCAELPQLLQT----NFHPHCRFRFKEESDVFS 80
           C+ C   I G  Y C  C       H+SC ELP  L      + HP            F 
Sbjct: 41  CYGCFETIHGPAYFCEICGDF--WLHKSCFELPSELPKHSLHSIHPLTLIVRPPSLAGF- 97

Query: 81  FKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFACAAT-----LIEHYRVQEHIIEHFSHR 135
                 F CD C     G+ + C  C F +   CA +     L     V+   I +F   
Sbjct: 98  ------FVCDGCRDMSPGFAFHCKACRFNLDVKCAISTDGEDLRSRKGVKNTEIPYFGDE 151

Query: 136 HPLIRLEVDEE---WCRICRNNILGPSYGCLPCKFYIHNSCSELPQQVLHPFHAHHSLKL 192
           H L+     +E    C  C+  + GP+YGCL C+FY+H SC ++P ++ HP+H  H L+ 
Sbjct: 152 HLLVSFNAKQEVEKTCTGCQLLLSGPAYGCLDCEFYLHESCKDMPSEIQHPYHPPHPLRA 211

Query: 193 QNTFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDC----ISVKPKIRYQGQEHLLVLMK 248
           Q    G   CDAC  M +    YRC ECDF+LH+ C    + V   ++++G EH L    
Sbjct: 212 QVAEYG-SECDAC-HMPIRKVFYRCSECDFNLHILCANKSLQVASSLKHKGHEHNLYYFV 269

Query: 249 SG--SGTTTCQACSFDTKPGAFFVRCVECDFKFHVQCGPASPPPIVEH----IHHGHSLT 302
           +   +  + C  C    K G++++ C+EC +  H+ C P   P +VE+     +H H LT
Sbjct: 270 ASYFNEYSVCNTCRKVCK-GSYYL-CLECKYYVHLDCIPL--PRVVENDCHSRYHSHYLT 325

Query: 303 LTLPTDSFVKDKFDLFYCDACKEEIDPQNPFCCCIEC----GYYIHWRC---TVIEVPLN 355
           L    D FV+D    +YC+ C+++ DP  P   C +C     Y  H  C    ++E  LN
Sbjct: 326 L---KDCFVEDDSGQYYCEFCEKKRDPTYPVYYCDQCPDRHPYLAHIECLMSELMEAELN 382

Query: 356 DT------------------------------------LVHFDHNHFLLPLENGTNDDVP 379
                                                 L  F H H L+P +N  +D   
Sbjct: 383 SARTSAKMVDDGDVKGDTKCLALVKYTTIPPENQIKMQLKGFRHEHILVP-DNEESDARR 441

Query: 380 CYAC---GKVLIQDQNHPTYGCDPCRIYLHKTCAQMPRQIQHVLH-RHPLTVTTNDGERG 435
            Y     GK+       P Y C  C    H +CA+ P +  H LH +H LT+      + 
Sbjct: 442 TYCSWCDGKIF-----GPGYICQECSGNWHISCAKSPPKKTHFLHSQHTLTMLYPHYFKY 496

Query: 436 RTCDACQKYLHGHI-YKCDSCDFVLDFDCATL---QSRVLNHT----------------- 474
             CD C+++ H    Y C  C F LD  CA+L   Q   L  T                 
Sbjct: 497 FICDGCREFCHDVAGYHCYECRFFLDMKCASLPDDQCEQLKKTESKTIYFCHKHKLTRAN 556

Query: 475 ------AKCRKYKFAISEASFQDCLKCNFTLHLMLSPLPLTIEHMSHHQHSLTLMDKHAD 528
                  KC+  +  IS A++  C+ CNF LH      P  I+H  H QH   L+ +  D
Sbjct: 557 CAKGIKEKCKVCQVRISGATYC-CINCNFFLHESCLETPQEIQHQYHLQHP--LLGRDFD 613

Query: 529 GNYGTQICDVCEEERDQQERVYYCEECDYIADFMCVIEVT 568
           GN   + C  C  +    +  YYC+ C++   F C   +T
Sbjct: 614 GN--PKNCRACNLQI--WDIAYYCDICEFALHFTCATYLT 649




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356572112|ref|XP_003554214.1| PREDICTED: uncharacterized protein LOC100810028 [Glycine max] Back     alignment and taxonomy information
>gi|449460291|ref|XP_004147879.1| PREDICTED: uncharacterized protein LOC101206551 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224139892|ref|XP_002323327.1| predicted protein [Populus trichocarpa] gi|222867957|gb|EEF05088.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224137826|ref|XP_002322661.1| predicted protein [Populus trichocarpa] gi|222867291|gb|EEF04422.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224139812|ref|XP_002323288.1| predicted protein [Populus trichocarpa] gi|222867918|gb|EEF05049.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15240290|ref|NP_198578.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|9757972|dbj|BAB08308.1| CHP-rich zinc finger protein-like [Arabidopsis thaliana] gi|332006828|gb|AED94211.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4678348|emb|CAB41158.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22331691|ref|NP_680115.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|332644891|gb|AEE78412.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449460297|ref|XP_004147882.1| PREDICTED: uncharacterized protein LOC101207273 [Cucumis sativus] gi|449511613|ref|XP_004164006.1| PREDICTED: uncharacterized LOC101207273 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query579
TAIR|locus:504955646 619 AT3G48400 "AT3G48400" [Arabido 0.706 0.660 0.254 1.3e-21
TAIR|locus:2151759652 AT5G37620 [Arabidopsis thalian 0.564 0.501 0.260 6.3e-41
TAIR|locus:2052531 569 AT2G21830 [Arabidopsis thalian 0.701 0.713 0.282 6.8e-40
TAIR|locus:2168123656 AT5G59930 [Arabidopsis thalian 0.514 0.454 0.270 7.8e-39
TAIR|locus:2168108 710 ULI3 "UV-B LIGHT INSENSITIVE 3 0.550 0.449 0.254 1.2e-35
TAIR|locus:504954854 664 AT5G22355 [Arabidopsis thalian 0.540 0.471 0.309 1.8e-27
TAIR|locus:2125083652 AT4G01350 [Arabidopsis thalian 0.538 0.478 0.267 1.8e-33
TAIR|locus:2141370 651 AT4G01910 [Arabidopsis thalian 0.649 0.577 0.273 1.8e-26
TAIR|locus:2102747 686 AT3G46810 [Arabidopsis thalian 0.678 0.572 0.255 6e-19
TAIR|locus:2077612574 AT3G07000 [Arabidopsis thalian 0.549 0.554 0.261 6.6e-16
TAIR|locus:504955646 AT3G48400 "AT3G48400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 282 (104.3 bits), Expect = 1.3e-21, P = 1.3e-21
 Identities = 119/467 (25%), Positives = 187/467 (40%)

Query:   134 HRHPLIRLE-VDEEWCRICRNNI-LGPSYGC--LPCKF-YIHNSCSELPQQVLHPFHAHH 188
             H+HPL          CR C+    +   Y C    C   + H  C E   ++ HP H  H
Sbjct:    10 HKHPLYHSSRFINGRCRGCKQTSPIYSGYRCNDSDCNHVWYHKECGESLPEINHPSHLEH 69

Query:   189 SLKLQNTFRGLLYCDACDSMIMSAKHYRCDECDFDLHLDCI--SVKPKIRYQGQE---HL 243
              L L + +RG   C  C + +     Y C  C F++ + C    + P    +  +   H 
Sbjct:    70 PLCLID-YRGSGTCAFCGAFLFGPT-YHCWICAFNIDIACARKQLPPLAAIENPKCHNHS 127

Query:   244 LVLMKSGSGTTTCQACSFDTKPGAFFVRCVECDFKFHVQCGPASPPPIVEHIHH-GHSLT 302
             LVL++       C  C   T  G +   C+ECD  FHV+C   S    V H  H  H+L 
Sbjct:   128 LVLLEKQVKKDHCGVCK-KTVFGMYPYVCLECDVYFHVECINISRE--VHHSSHTNHTLE 184

Query:   303 L----TLPTDSFVKDKFDLFYCDACKEEIDPQNPFCCCIECGYYIHWRCTVIEVPLNDTL 358
             L    +LP DS  K       C  C +++     + C + C + I   C +   PL   +
Sbjct:   185 LFGSESLP-DSAQKT------CLLC-DDVSDHLIYHCSV-CNFSICVYCAINPPPL--AI 233

Query:   359 VHFD-HNHFLLPLENGTNDDVPCYACGKVLIQDQNHPTYGCDPCRIYLHKTCAQMPRQIQ 417
              H   H H L  L         C ACG   ++    P Y C  C   +H+ C  +PR I 
Sbjct:   234 EHLKTHEHTLTLLPRQVK--FICNACG---MKGDGCP-YFCLGCGYLIHRKCIDLPRVIN 287

Query:   418 HVLHRHPLTVTTNDGERGRTCDACQKYLHGHI--YKCDSC-DFVLDFDCATLQSRVLNHT 474
                H H +++T + G +   C  C++ ++G+   Y C  C ++V+   CA ++  V +  
Sbjct:   288 INRHDHRISLTHHLGLQYSECGVCRQSVNGYYGGYSCSLCPNYVVHPQCA-MKDDVWDGI 346

Query:   475 AKCRKYKFAISEASFQDCLKCNFTLHLMLSPLPLTIEHMSHHQHSLTLMDKHADGNYGTQ 534
                        E + +D  +      ++      TI+H SH +H+L +++K+       +
Sbjct:   347 EL---------EGTPEDSEQDTAPFEVVDDN---TIKHFSHEKHNL-MLNKNGIITQHDE 393

Query:   535 I--CDVCEEERDQQERVYYCEECDYIADFMCVIEVTKPTDYFLEKSY 579
             I  C  C          Y C +CDY+    C     K    F  K +
Sbjct:   394 ITRCQACVLPLSSDPS-YSCGQCDYVLHETCANLPRKKRHVFNNKPF 439


GO:0005575 "cellular_component" evidence=ND
GO:0047134 "protein-disulfide reductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2151759 AT5G37620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052531 AT2G21830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168123 AT5G59930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168108 ULI3 "UV-B LIGHT INSENSITIVE 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504954854 AT5G22355 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125083 AT4G01350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141370 AT4G01910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102747 AT3G46810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077612 AT3G07000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00190202
hypothetical protein (838 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 579
PF0310730 C1_2: C1 domain; InterPro: IPR004146 This short do 98.41
PF0310730 C1_2: C1 domain; InterPro: IPR004146 This short do 98.32
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 98.24
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 98.0
cd0234043 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre 97.36
cd0234043 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre 96.99
KOG0696683 consensus Serine/threonine protein kinase [Signal 96.52
cd0233849 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger pre 96.18
cd0224946 ZZ Zinc finger, ZZ type. Zinc finger present in dy 96.15
cd0224946 ZZ Zinc finger, ZZ type. Zinc finger present in dy 96.11
cd0233945 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger pre 96.11
cd0233945 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger pre 96.07
PF0013053 C1_1: Phorbol esters/diacylglycerol binding domain 95.93
cd0233849 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger pre 95.69
cd0234445 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present 95.61
cd0234445 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present 95.6
cd0233549 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present 95.58
cd0234243 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger pre 95.42
PF0013053 C1_1: Phorbol esters/diacylglycerol binding domain 95.38
cd0233449 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger pr 95.19
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 95.13
KOG0696 683 consensus Serine/threonine protein kinase [Signal 94.9
cd0234243 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger pre 94.85
cd0234148 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present 94.8
cd0233449 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger pr 94.73
cd0234148 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present 94.63
cd0233741 ZZ_CBP Zinc finger, ZZ type. Zinc finger present i 94.6
smart0029144 ZnF_ZZ Zinc-binding domain, present in Dystrophin, 94.41
cd0234348 ZZ_EF Zinc finger, ZZ type. Zinc finger present in 94.27
PF0056946 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc 93.97
cd0234348 ZZ_EF Zinc finger, ZZ type. Zinc finger present in 93.96
cd0234549 ZZ_dah Zinc finger, ZZ type. Zinc finger present i 93.95
cd0002950 C1 Protein kinase C conserved region 1 (C1) . Cyst 93.64
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 93.62
PF0056946 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc 93.61
cd0234549 ZZ_dah Zinc finger, ZZ type. Zinc finger present i 93.54
smart0029144 ZnF_ZZ Zinc-binding domain, present in Dystrophin, 93.54
cd0233549 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present 93.02
KOG1280 381 consensus Uncharacterized conserved protein contai 92.93
smart0010949 C1 Protein kinase C conserved region 1 (C1) domain 92.5
cd0233741 ZZ_CBP Zinc finger, ZZ type. Zinc finger present i 91.86
KOG1280381 consensus Uncharacterized conserved protein contai 91.35
cd0002950 C1 Protein kinase C conserved region 1 (C1) . Cyst 90.68
smart0010949 C1 Protein kinase C conserved region 1 (C1) domain 89.9
KOG0956 900 consensus PHD finger protein AF10 [General functio 89.24
KOG0957707 consensus PHD finger protein [General function pre 86.95
KOG4582278 consensus Uncharacterized conserved protein, conta 86.82
KOG0957707 consensus PHD finger protein [General function pre 86.15
KOG4582278 consensus Uncharacterized conserved protein, conta 85.4
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 84.35
KOG1512381 consensus PHD Zn-finger protein [General function 80.78
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 80.09
>PF03107 C1_2: C1 domain; InterPro: IPR004146 This short domain is rich in cysteines and histidines Back     alignment and domain information
Probab=98.41  E-value=1.5e-07  Score=63.08  Aligned_cols=30  Identities=43%  Similarity=1.115  Sum_probs=28.4

Q ss_pred             ccccccccccCCCCCeeeecccCeEEecccc
Q 039635          318 FYCDACKEEIDPQNPFCCCIECGYYIHWRCT  348 (579)
Q Consensus       318 ~~C~~C~~~~~~~~~~Y~C~~C~f~lh~~C~  348 (579)
                      |+|++|++++++++ +|+|++|+|++|++||
T Consensus         1 ~~C~~C~~~~~~~~-~Y~C~~c~f~lh~~Ca   30 (30)
T PF03107_consen    1 FWCDVCRRKIDGFY-FYHCSECCFTLHVRCA   30 (30)
T ss_pred             CCCCCCCCCcCCCE-eEEeCCCCCeEcCccC
Confidence            57999999999988 9999999999999997



The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.

>PF03107 C1_2: C1 domain; InterPro: IPR004146 This short domain is rich in cysteines and histidines Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type Back     alignment and domain information
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type Back     alignment and domain information
>cd02249 ZZ Zinc finger, ZZ type Back     alignment and domain information
>cd02249 ZZ Zinc finger, ZZ type Back     alignment and domain information
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type Back     alignment and domain information
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type Back     alignment and domain information
>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger Back     alignment and domain information
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type Back     alignment and domain information
>cd02344 ZZ_HERC2 Zinc finger, ZZ type Back     alignment and domain information
>cd02344 ZZ_HERC2 Zinc finger, ZZ type Back     alignment and domain information
>cd02335 ZZ_ADA2 Zinc finger, ZZ type Back     alignment and domain information
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type Back     alignment and domain information
>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger Back     alignment and domain information
>cd02334 ZZ_dystrophin Zinc finger, ZZ type Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type Back     alignment and domain information
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type Back     alignment and domain information
>cd02334 ZZ_dystrophin Zinc finger, ZZ type Back     alignment and domain information
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type Back     alignment and domain information
>cd02337 ZZ_CBP Zinc finger, ZZ type Back     alignment and domain information
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein Back     alignment and domain information
>cd02343 ZZ_EF Zinc finger, ZZ type Back     alignment and domain information
>PF00569 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd02343 ZZ_EF Zinc finger, ZZ type Back     alignment and domain information
>cd02345 ZZ_dah Zinc finger, ZZ type Back     alignment and domain information
>cd00029 C1 Protein kinase C conserved region 1 (C1) Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF00569 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd02345 ZZ_dah Zinc finger, ZZ type Back     alignment and domain information
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein Back     alignment and domain information
>cd02335 ZZ_ADA2 Zinc finger, ZZ type Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains) Back     alignment and domain information
>cd02337 ZZ_CBP Zinc finger, ZZ type Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>cd00029 C1 Protein kinase C conserved region 1 (C1) Back     alignment and domain information
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains) Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query579
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 6e-13
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 2e-11
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 3e-07
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 8e-07
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 1e-06
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 2e-05
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 3e-04
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 5e-04
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
 Score = 63.8 bits (155), Expect = 6e-13
 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 3/75 (4%)

Query: 162 CLPCKFYIHNSCSELPQQVLHPFHAHHSLKLQNTFRGLLYCDACDSMIMSAKHYRCDECD 221
               +        + P++V H  H  H L+L  T   +  CD C+    +   Y CDECD
Sbjct: 12  LKEIEAKYDEIAKDWPKKVKHVLHEEHELEL--TRVQVYTCDKCEEEG-TIWSYHCDECD 68

Query: 222 FDLHLDCISVKPKIR 236
           FDLH  C   +    
Sbjct: 69  FDLHAKCALNEDTKE 83


>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query579
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 99.47
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 99.46
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 97.16
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 96.85
1tot_A52 CREB-binding protein; zinc binding, CBP, TAZ2, tra 96.22
1ptq_A50 Protein kinase C delta type; phosphotransferase; 1 95.55
2enz_A65 NPKC-theta, protein kinase C theta type; zinc bind 95.33
1kbe_A49 Kinase suppressor of RAS; KSR, cysteine-rich domai 95.32
1ptq_A50 Protein kinase C delta type; phosphotransferase; 1 95.26
1faq_A52 RAF-1; transferase, serine/threonine-protein kinas 95.18
2fc7_A82 ZZZ3 protein; structure genomics, ZZ domain, struc 95.15
2dip_A98 Zinc finger SWIM domain-containing protein 2; ZZ d 95.07
2fc7_A82 ZZZ3 protein; structure genomics, ZZ domain, struc 95.07
2e5r_A63 Dystrobrevin alpha; ZZ domain, structural genomics 95.03
1rfh_A59 RAS association (ralgds/AF-6) domain family 5; zin 94.85
2db6_A74 SH3 and cysteine rich domain 3; STAC3, C1 domain, 94.8
2fnf_X72 Putative RAS effector NORE1; zinc, signal transduc 94.78
1kbe_A49 Kinase suppressor of RAS; KSR, cysteine-rich domai 94.77
2eli_A85 Protein kinase C alpha type; PKC-alpha, PKC-A, str 94.69
3uej_A65 NPKC-delta, protein kinase C delta type; proteine 94.67
2e5r_A63 Dystrobrevin alpha; ZZ domain, structural genomics 94.54
3uej_A65 NPKC-delta, protein kinase C delta type; proteine 94.47
1y8f_A66 UNC-13 homolog A, MUNC13-1; cysteine-rich domain, 94.46
2yuu_A83 NPKC-delta, protein kinase C delta type; metal bin 94.17
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 94.16
1y8f_A66 UNC-13 homolog A, MUNC13-1; cysteine-rich domain, 94.1
2enn_A77 NPKC-theta, protein kinase C theta type; zinc bind 93.87
2enz_A65 NPKC-theta, protein kinase C theta type; zinc bind 93.67
2db6_A74 SH3 and cysteine rich domain 3; STAC3, C1 domain, 93.56
2eli_A85 Protein kinase C alpha type; PKC-alpha, PKC-A, str 93.53
1faq_A52 RAF-1; transferase, serine/threonine-protein kinas 93.48
2enn_A77 NPKC-theta, protein kinase C theta type; zinc bind 93.44
2dip_A98 Zinc finger SWIM domain-containing protein 2; ZZ d 93.38
1tot_A52 CREB-binding protein; zinc binding, CBP, TAZ2, tra 93.17
1rfh_A59 RAS association (ralgds/AF-6) domain family 5; zin 93.06
2fnf_X72 Putative RAS effector NORE1; zinc, signal transduc 92.92
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 92.84
2yuu_A83 NPKC-delta, protein kinase C delta type; metal bin 92.29
4b6d_A61 RAC GTPase-activating protein 1; signaling protein 91.83
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 90.87
2row_A84 RHO-associated protein kinase 2; ATP-binding, coil 90.65
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 89.77
4b6d_A61 RAC GTPase-activating protein 1; signaling protein 88.95
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 88.14
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 87.85
2row_A84 RHO-associated protein kinase 2; ATP-binding, coil 87.7
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 86.47
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 84.63
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 83.24
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 82.6
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 81.59
1r79_A84 Diacylglycerol kinase, delta; C1 domain, cystein-r 81.44
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 81.09
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Back     alignment and structure
Probab=99.47  E-value=2.5e-14  Score=119.89  Aligned_cols=63  Identities=19%  Similarity=0.527  Sum_probs=57.5

Q ss_pred             cccccccCCCccEeecCCCCCceEEeeccccccccccccccccccccCCCCCeeecCCCCcccChhhhcccc
Q 039635           48 LFHQSCAELPQLLQTNFHPHCRFRFKEESDVFSFKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFACAATLI  119 (579)
Q Consensus        48 ~~Hk~C~~~p~~I~hp~Hp~H~L~l~~~~~~~~~~~~~~~~C~~C~~~~~g~~Y~C~~C~f~lh~~Ca~~~~  119 (579)
                      .+|++|+++|++|+||+||+|||+|...        . .+.|++|++.+.+..|+|+.|||+||..||..|+
T Consensus        18 ~lhe~Ca~lP~~i~Hp~Hp~H~L~L~~~--------~-~~~C~~C~~~~~~~~Y~C~~C~f~lH~~Ca~~p~   80 (89)
T 1v5n_A           18 KYDEIAKDWPKKVKHVLHEEHELELTRV--------Q-VYTCDKCEEEGTIWSYHCDECDFDLHAKCALNED   80 (89)
T ss_dssp             HHHHHTSSSCSEECCSTTTTSCEEEECC--------S-SCCCTTTSCCCCSCEEECTTTCCCCCHHHHHCSS
T ss_pred             HHhHHHHcCCceecCCCCCCCccEEeeC--------C-CeEeCCCCCcCCCcEEEcCCCCCeEcHHhcCCCC
Confidence            7999999999999999999999999751        1 4689999999988889999999999999999876



>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1tot_A CREB-binding protein; zinc binding, CBP, TAZ2, transferase; NMR {Mus musculus} SCOP: g.44.1.6 Back     alignment and structure
>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* Back     alignment and structure
>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A Back     alignment and structure
>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* Back     alignment and structure
>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A Back     alignment and structure
>2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} Back     alignment and structure
>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} Back     alignment and structure
>1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A Back     alignment and structure
>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A* Back     alignment and structure
>2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A* Back     alignment and structure
>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Back     alignment and structure
>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Back     alignment and structure
>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A Back     alignment and structure
>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>1tot_A CREB-binding protein; zinc binding, CBP, TAZ2, transferase; NMR {Mus musculus} SCOP: g.44.1.6 Back     alignment and structure
>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} Back     alignment and structure
>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1r79_A Diacylglycerol kinase, delta; C1 domain, cystein-rich zinc binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: g.49.1.1 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 579
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 3e-10
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 3e-10
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 2e-06
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 3e-06
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 9e-05
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 2e-04
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 0.001
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure

class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: C1-like domain
domain: Pdi-like hypothetical protein At1g60420
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 54.9 bits (132), Expect = 3e-10
 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 3/75 (4%)

Query: 162 CLPCKFYIHNSCSELPQQVLHPFHAHHSLKLQNTFRGLLYCDACDSMIMSAKHYRCDECD 221
               +        + P++V H  H  H L+L  T   +  CD C+    +   Y CDECD
Sbjct: 12  LKEIEAKYDEIAKDWPKKVKHVLHEEHELEL--TRVQVYTCDKCEEEG-TIWSYHCDECD 68

Query: 222 FDLHLDCISVKPKIR 236
           FDLH  C   +    
Sbjct: 69  FDLHAKCALNEDTKE 83


>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query579
d1v5na_89 Pdi-like hypothetical protein At1g60420 {Thale cre 99.61
d1v5na_89 Pdi-like hypothetical protein At1g60420 {Thale cre 99.55
d1tota152 CREB-binding protein, CBP {Mouse (Mus musculus) [T 96.17
d1tbna_66 Protein kinase c-gamma {Rat (Rattus rattus) [TaxId 96.02
d1faqa_52 RAF-1 {Human (Homo sapiens) [TaxId: 9606]} 95.95
d1ptqa_50 Protein kinase C-delta (PKCdelta) {Mouse (Mus musc 95.78
d1ptqa_50 Protein kinase C-delta (PKCdelta) {Mouse (Mus musc 95.52
d1tbna_66 Protein kinase c-gamma {Rat (Rattus rattus) [TaxId 95.43
d2fc7a169 Zinc finger ZZ-type-containing protein 3, ZZZ3 {Hu 95.41
d1faqa_52 RAF-1 {Human (Homo sapiens) [TaxId: 9606]} 95.26
d1kbea_49 Kinase suppressor of Ras, Ksr {Mouse (Mus musculus 95.15
d1kbea_49 Kinase suppressor of Ras, Ksr {Mouse (Mus musculus 95.04
d1xa6a362 Beta-chimaerin, middle domain {Human (Homo sapiens 94.8
d1xa6a362 Beta-chimaerin, middle domain {Human (Homo sapiens 94.78
d2dipa185 Zinc finger ZZ-type-containing protein 2 {Human (H 94.63
d2fc7a169 Zinc finger ZZ-type-containing protein 3, ZZZ3 {Hu 94.42
d2dipa185 Zinc finger ZZ-type-containing protein 2 {Human (H 94.07
d1tota152 CREB-binding protein, CBP {Mouse (Mus musculus) [T 93.51
d1r79a_84 Diacylglycerol kinase delta {Human (Homo sapiens) 92.42
d1r79a_84 Diacylglycerol kinase delta {Human (Homo sapiens) 92.24
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 88.87
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 87.45
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 85.84
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 81.3
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: C1-like domain
domain: Pdi-like hypothetical protein At1g60420
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.61  E-value=7.1e-17  Score=132.77  Aligned_cols=74  Identities=18%  Similarity=0.451  Sum_probs=67.1

Q ss_pred             CCcEEcCCCCCCCccccccccCCCccEeecCCCCCceEEeeccccccccccccccccccccCCCCCeeecCCCCcccChh
Q 039635           34 GNFYICGHCDSDSPLFHQSCAELPQLLQTNFHPHCRFRFKEESDVFSFKRTLEFGCDFCDQSHKGYKYCCDLCNFQIGFA  113 (579)
Q Consensus        34 ~~~Y~C~~C~~~~~~~Hk~C~~~p~~I~hp~Hp~H~L~l~~~~~~~~~~~~~~~~C~~C~~~~~g~~Y~C~~C~f~lh~~  113 (579)
                      |..|+|.+|++   .+|++|+++|++|+||+||+|+|+|..       ..  .+.|++|++.+.|+.|+|.+|||+||..
T Consensus         7 ~t~~~~~e~~~---~~he~c~~~P~~I~Hp~Hp~H~L~L~~-------~~--~~~C~~C~~~~~g~~Y~C~~C~f~LH~~   74 (89)
T d1v5na_           7 GTEERLKEIEA---KYDEIAKDWPKKVKHVLHEEHELELTR-------VQ--VYTCDKCEEEGTIWSYHCDECDFDLHAK   74 (89)
T ss_dssp             CCSSCCSHHHH---HHHHHTSSSCSEECCSTTTTSCEEEEC-------CS--SCCCTTTSCCCCSCEEECTTTCCCCCHH
T ss_pred             chHHHHHHHHh---hhhHHHhcCCCeecCCCCCCCCeEEec-------CC--CCEeCCCCCCcCCcEeEeccCCCEecHH
Confidence            33799999999   999999999999999999999999875       11  5689999999988889999999999999


Q ss_pred             hhcccc
Q 039635          114 CAATLI  119 (579)
Q Consensus       114 Ca~~~~  119 (579)
                      ||..|.
T Consensus        75 CA~~P~   80 (89)
T d1v5na_          75 CALNED   80 (89)
T ss_dssp             HHHCSS
T ss_pred             HcCCCc
Confidence            999876



>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure