Citrus Sinensis ID: 039654

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----

MSGMSSKKSKGRQKVEMVKMPNESNLQVTFSKRRTGLFKKASELCTLCGADIAIIVFSPGKKVFSFGHPCVETIVDRYLTRNPPQISGTMQLIEAHRNASVRELNMQLTQVLNQLEIEKKRGEELNQMRKASQAQCWWEAPIEELNLPQLEQLKMSLEELKKNVGKQAEKMLIQSSNPPQFFAGSSSNAGGMNLPFDPNNNAAVFNPNNMMPHPGYNPGFGHGFY

ccccccccccccccccccccccccccHHHHHcccccHHHHHHHHHHHHcccEEEEEEcccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccc

*****************VKMPNESNLQVTFSKRRTGLFKKASELCTLCGADIAIIVFSPGKKVFSFGHPCVETIVDRYLTRNPPQISGTMQL**AHRNASVRELNMQLTQVLNQ*******************AQCWWEAPIEELNLPQLEQLKMSLEEL*****************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSGMSSKKSKGRQKVEMVKMPNESNLQVTFSKRRTGLFKKASELCTLCGADIAIIVFSPGKKVFSFGHPCVETIVDRYLTRNPPQISGTMQLIEAHRxxxxxxxxxxxxxxxxxxxxxxxxxxxxNQMRKASQAQCWWEAPIEELNLPQxxxxxxxxxxxxxxxxxxxxxMLIQSSNPPQFFAGSSSNAGGMNLPFDPNNNAAVFNPNNMMPHPGYNPGFGHGFY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
MADS-box transcription factor 3	Probable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58.	probable	Q40704
Agamous-like MADS-box protein AGL62	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development.	probable	Q9FKK2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MNM, chain A
Confidence level:very confident
Coverage over the Query: 9-80
View the alignment between query and template
View the model in PyMOL