Citrus Sinensis ID: 039732
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| 53988164 | 323 | aldo/keto reductase [Fragaria x ananassa | 0.939 | 0.622 | 0.633 | 2e-76 | |
| 255578325 | 320 | aldo-keto reductase, putative [Ricinus c | 0.939 | 0.628 | 0.653 | 4e-76 | |
| 255558364 | 325 | aldo-keto reductase, putative [Ricinus c | 0.995 | 0.655 | 0.579 | 1e-74 | |
| 255561785 | 325 | aldo-keto reductase, putative [Ricinus c | 0.995 | 0.655 | 0.607 | 8e-74 | |
| 224102497 | 305 | predicted protein [Populus trichocarpa] | 0.985 | 0.691 | 0.589 | 7e-72 | |
| 75266185 | 321 | RecName: Full=Non-functional NADPH-depen | 0.995 | 0.663 | 0.574 | 8e-72 | |
| 40781598 | 321 | reductase 2 [Hydrangea macrophylla] gi|4 | 0.985 | 0.657 | 0.589 | 2e-71 | |
| 326496278 | 314 | predicted protein [Hordeum vulgare subsp | 0.990 | 0.675 | 0.558 | 4e-71 | |
| 112807100 | 314 | deoxymugineic acid synthase1 [Hordeum vu | 0.990 | 0.675 | 0.558 | 5e-71 | |
| 357113228 | 315 | PREDICTED: probable NAD(P)H-dependent ox | 0.985 | 0.669 | 0.561 | 6e-71 |
| >gi|53988164|gb|AAV28174.1| aldo/keto reductase [Fragaria x ananassa] | Back alignment and taxonomy information |
|---|
Score = 291 bits (744), Expect = 2e-76, Method: Compositional matrix adjust.
Identities = 128/202 (63%), Positives = 168/202 (83%), Gaps = 1/202 (0%)
Query: 12 IHWPISAKPSEKLQSLIPKEDLVPLDYKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALL 71
IHWPISAKP KL + ++D +P+D+KGVW MEE QRLGLTK IG+SNFS+KK + LL
Sbjct: 120 IHWPISAKPG-KLSHALEEKDQMPMDFKGVWADMEEAQRLGLTKSIGISNFSTKKTQNLL 178
Query: 72 AFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSWGTNQVMNNEALKQ 131
+F+TIPPSVNQVEM+P WQQ++LR+FCK+ I+VTAFSPLGA G+SWGTN V+ ++ L +
Sbjct: 179 SFATIPPSVNQVEMSPFWQQKKLRDFCKASGIVVTAFSPLGAIGTSWGTNHVLESKVLNE 238
Query: 132 IADAHGKTVAQVCLRWIIEQGAIVVAKSFNKERLKENLDIFDWALTDHDYDKINQIPQHR 191
IA+AHGKTVAQVC+RW+ + GA + KS+NKERLK+N+ +FDW LT+ D +KINQIPQ +
Sbjct: 239 IAEAHGKTVAQVCIRWVYQVGATLAVKSYNKERLKQNVQVFDWELTEEDLEKINQIPQRK 298
Query: 192 MMPRDEYITPHGPFKTLEELWD 213
MMPR+E +T GP+K+L++LWD
Sbjct: 299 MMPREELVTATGPYKSLDDLWD 320
|
Source: Fragaria x ananassa Species: Fragaria x ananassa Genus: Fragaria Family: Rosaceae Order: Rosales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255578325|ref|XP_002530029.1| aldo-keto reductase, putative [Ricinus communis] gi|223530445|gb|EEF32329.1| aldo-keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255558364|ref|XP_002520209.1| aldo-keto reductase, putative [Ricinus communis] gi|223540701|gb|EEF42264.1| aldo-keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255561785|ref|XP_002521902.1| aldo-keto reductase, putative [Ricinus communis] gi|223538940|gb|EEF40538.1| aldo-keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224102497|ref|XP_002312700.1| predicted protein [Populus trichocarpa] gi|222852520|gb|EEE90067.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|75266185|sp|Q9SQ64.1|COR2_PAPSO RecName: Full=Non-functional NADPH-dependent codeinone reductase 2 gi|6478216|gb|AAF13742.1|AF108438_1 putative NADPH-dependent oxidoreductase [Papaver somniferum] | Back alignment and taxonomy information |
|---|
| >gi|40781598|gb|AAR89808.1| reductase 2 [Hydrangea macrophylla] gi|40781601|gb|AAR89810.1| reductase 2 [Hydrangea macrophylla] | Back alignment and taxonomy information |
|---|
| >gi|326496278|dbj|BAJ94601.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|112807100|dbj|BAF03162.1| deoxymugineic acid synthase1 [Hordeum vulgare] | Back alignment and taxonomy information |
|---|
| >gi|357113228|ref|XP_003558406.1| PREDICTED: probable NAD(P)H-dependent oxidoreductase 1-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| UNIPROTKB|Q9SQ64 | 321 | COR2 "Non-functional NADPH-dep | 0.990 | 0.660 | 0.577 | 4.9e-69 | |
| TAIR|locus:2025926 | 320 | AT1G59950 [Arabidopsis thalian | 0.990 | 0.662 | 0.560 | 5.8e-66 | |
| UNIPROTKB|Q9SQ67 | 321 | COR1.4 "NADPH-dependent codein | 0.990 | 0.660 | 0.572 | 2.9e-64 | |
| TAIR|locus:2025936 | 326 | AT1G59960 [Arabidopsis thalian | 0.985 | 0.647 | 0.553 | 6e-64 | |
| UNIPROTKB|Q9SQ69 | 321 | COR1.2 "NADPH-dependent codein | 0.990 | 0.660 | 0.572 | 1.6e-63 | |
| UNIPROTKB|B9VRJ2 | 321 | COR1.5 "NADPH-dependent codein | 0.990 | 0.660 | 0.563 | 3.3e-63 | |
| UNIPROTKB|Q9SQ70 | 321 | COR1.1 "NADPH-dependent codein | 0.990 | 0.660 | 0.558 | 5.4e-63 | |
| UNIPROTKB|Q9SQ68 | 321 | COR1.3 "NADPH-dependent codein | 0.990 | 0.660 | 0.563 | 6.9e-63 | |
| UNIPROTKB|E7C196 | 327 | E7C196 "2-carbomethoxy-3-tropi | 0.990 | 0.648 | 0.550 | 1.2e-58 | |
| TAIR|locus:2065639 | 314 | AKR4C10 "Aldo-keto reductase f | 0.976 | 0.665 | 0.452 | 1.5e-49 |
| UNIPROTKB|Q9SQ64 COR2 "Non-functional NADPH-dependent codeinone reductase 2" [Papaver somniferum (taxid:3469)] | Back alignment and assigned GO terms |
|---|
Score = 700 (251.5 bits), Expect = 4.9e-69, P = 4.9e-69
Identities = 123/213 (57%), Positives = 169/213 (79%)
Query: 2 LQMDYVDLYLIHWPISAKPSEKLQSLIPKEDLVPLDYKGVWEAMEECQRLGLTKFIGVSN 61
L+++Y+DLYLIHWP+S KP K IPK+++ P+DYK VW AME+CQ LGLTK IGVSN
Sbjct: 108 LKLEYLDLYLIHWPVSLKPG-KFVHPIPKDEIFPIDYKSVWAAMEKCQMLGLTKSIGVSN 166
Query: 62 FSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSWGTN 121
FS KK+ L+A + IPP+VNQVEMNP WQQ++LR++CK+ +I+VTA+SPLGA G+ WG++
Sbjct: 167 FSCKKLHYLMATANIPPAVNQVEMNPIWQQQKLRDYCKTNNIMVTAYSPLGAKGTMWGSS 226
Query: 122 QVMNNEALKQIADAHGKTVAQVCLRWIIEQGAIVVAKSFNKERLKENLDIFDWALTDHDY 181
VM++E L QI+ GK+VAQV LRW+ EQGA ++ KSFN+ER+KENL IFDW L+ D
Sbjct: 227 GVMDSEVLNQISQVRGKSVAQVSLRWVYEQGASLLVKSFNEERMKENLKIFDWELSPEDL 286
Query: 182 DKINQIPQHRMMPRDEYITPHGPFKTLEELWDE 214
I+++PQ R+ D +++ +GPFK++EELWD+
Sbjct: 287 KNISELPQRRVSTGDPFVSINGPFKSVEELWDD 319
|
|
| TAIR|locus:2025926 AT1G59950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9SQ67 COR1.4 "NADPH-dependent codeinone reductase 1-4" [Papaver somniferum (taxid:3469)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025936 AT1G59960 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9SQ69 COR1.2 "NADPH-dependent codeinone reductase 1-2" [Papaver somniferum (taxid:3469)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B9VRJ2 COR1.5 "NADPH-dependent codeinone reductase 1-5" [Papaver somniferum (taxid:3469)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9SQ70 COR1.1 "NADPH-dependent codeinone reductase 1-1" [Papaver somniferum (taxid:3469)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9SQ68 COR1.3 "NADPH-dependent codeinone reductase 1-3" [Papaver somniferum (taxid:3469)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7C196 E7C196 "2-carbomethoxy-3-tropinone reductase" [Erythroxylum coca (taxid:289672)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2065639 AKR4C10 "Aldo-keto reductase family 4 member C10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| COG0656 | 280 | COG0656, ARA1, Aldo/keto reductases, related to di | 5e-65 | |
| cd06660 | 285 | cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) | 4e-59 | |
| pfam00248 | 277 | pfam00248, Aldo_ket_red, Aldo/keto reductase famil | 2e-42 | |
| PRK11565 | 275 | PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A | 3e-40 | |
| PRK11172 | 267 | PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B | 3e-30 | |
| COG0667 | 316 | COG0667, Tas, Predicted oxidoreductases (related t | 8e-27 | |
| COG4989 | 298 | COG4989, COG4989, Predicted oxidoreductase [Genera | 8e-09 | |
| COG1453 | 391 | COG1453, COG1453, Predicted oxidoreductases of the | 8e-06 | |
| PRK10625 | 346 | PRK10625, tas, putative aldo-keto reductase; Provi | 6e-05 |
| >gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
Score = 201 bits (514), Expect = 5e-65
Identities = 75/184 (40%), Positives = 110/184 (59%), Gaps = 21/184 (11%)
Query: 2 LQMDYVDLYLIHWPISAKPSEKLQSLIPKEDLVPLDYKGVWEAMEECQRLGLTKFIGVSN 61
L +DYVDLYLIHWP+ P + +V + W+A+EE GL + IGVSN
Sbjct: 98 LGLDYVDLYLIHWPV------------PNKYVVIEE---TWKALEELVDEGLIRAIGVSN 142
Query: 62 FSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSWGTN 121
F + +E LL+ + + P+VNQ+E +P +Q +L FC+ I V A+SPL G
Sbjct: 143 FGVEHLEELLSLAKVKPAVNQIEYHPYLRQPELLPFCQRHGIAVEAYSPLAKGG------ 196
Query: 122 QVMNNEALKQIADAHGKTVAQVCLRWIIEQGAIVVAKSFNKERLKENLDIFDWALTDHDY 181
++++N L +IA +GKT AQV LRW I++G IV+ KS ER++ENL FD+ L++ D
Sbjct: 197 KLLDNPVLAEIAKKYGKTPAQVALRWHIQRGVIVIPKSTTPERIRENLAAFDFELSEEDM 256
Query: 182 DKIN 185
I+
Sbjct: 257 AAID 260
|
Length = 280 |
| >gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| COG0656 | 280 | ARA1 Aldo/keto reductases, related to diketogulona | 100.0 | |
| KOG1577 | 300 | consensus Aldo/keto reductase family proteins [Gen | 100.0 | |
| KOG1575 | 336 | consensus Voltage-gated shaker-like K+ channel, su | 100.0 | |
| PRK11172 | 267 | dkgB 2,5-diketo-D-gluconate reductase B; Provision | 100.0 | |
| COG0667 | 316 | Tas Predicted oxidoreductases (related to aryl-alc | 100.0 | |
| PRK09912 | 346 | L-glyceraldehyde 3-phosphate reductase; Provisiona | 100.0 | |
| TIGR01293 | 317 | Kv_beta voltage-dependent potassium channel beta s | 100.0 | |
| PRK11565 | 275 | dkgA 2,5-diketo-D-gluconate reductase A; Provision | 100.0 | |
| PRK10625 | 346 | tas putative aldo-keto reductase; Provisional | 100.0 | |
| PF00248 | 283 | Aldo_ket_red: Aldo/keto reductase family; InterPro | 100.0 | |
| cd06660 | 285 | Aldo_ket_red Aldo-keto reductases (AKRs) are a sup | 100.0 | |
| PRK10376 | 290 | putative oxidoreductase; Provisional | 100.0 | |
| PLN02587 | 314 | L-galactose dehydrogenase | 100.0 | |
| PRK14863 | 292 | bifunctional regulator KidO; Provisional | 100.0 | |
| COG4989 | 298 | Predicted oxidoreductase [General function predict | 100.0 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 99.94 | |
| KOG1576 | 342 | consensus Predicted oxidoreductase [Energy product | 99.92 | |
| KOG3023 | 285 | consensus Glutamate-cysteine ligase regulatory sub | 98.6 | |
| PRK10558 | 256 | alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro | 91.81 | |
| PRK10128 | 267 | 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional | 90.13 | |
| TIGR03239 | 249 | GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co | 89.94 | |
| TIGR02311 | 249 | HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola | 85.1 | |
| TIGR01228 | 545 | hutU urocanate hydratase. This model represents th | 82.07 | |
| PRK05414 | 556 | urocanate hydratase; Provisional | 81.75 |
| >COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-42 Score=282.22 Aligned_cols=172 Identities=43% Similarity=0.761 Sum_probs=159.3
Q ss_pred CCCCCeeeEEEEecCCCCCCCcccccCCCcCCCCCCCHHHHHHHHHHHHHcCCccEEEecCCCHHHHHHHHhcCCCCCee
Q 039732 1 TLQMDYVDLYLIHWPISAKPSEKLQSLIPKEDLVPLDYKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSV 80 (214)
Q Consensus 1 rL~tdyiDl~~lH~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~l~~l~~~Gkir~iGiS~~~~~~l~~~~~~~~~~~~~ 80 (214)
|||+||||+|++|||.+... ....|+|++|++++++||||+||||||+.+.++++++..++.|.+
T Consensus 97 rLg~dyvDLyLiHwP~~~~~---------------~~~~etw~alE~l~~~G~ir~IGVSNF~~~~L~~l~~~~~~~p~~ 161 (280)
T COG0656 97 RLGLDYVDLYLIHWPVPNKY---------------VVIEETWKALEELVDEGLIRAIGVSNFGVEHLEELLSLAKVKPAV 161 (280)
T ss_pred HhCCCceeEEEECCCCCccC---------------ccHHHHHHHHHHHHhcCCccEEEeeCCCHHHHHHHHHhcCCCCce
Confidence 69999999999999975411 116899999999999999999999999999999999999899999
Q ss_pred eecccCcccchHHHHHHHHhCCCeEEEeccCCCCCCCCCCCCCCChHHHHHHHHHhCCCHHHHHHHHHhhcCcEEeeCCC
Q 039732 81 NQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSWGTNQVMNNEALKQIADAHGKTVAQVCLRWIIEQGAIVVAKSF 160 (214)
Q Consensus 81 ~q~~~~~~~~~~~~~~~~~~~gi~vi~~~~l~~~G~L~~~~~~~~~~~l~~~a~~~~~s~~q~al~~~l~~~~~vl~g~~ 160 (214)
+|++||++.++.+++++|+++||.+++|+||+. |. .++..+.+..+|+++|.|++|++|+|.+++|.++||.++
T Consensus 162 NQIe~hp~~~q~el~~~~~~~gI~v~AysPL~~-g~-----~l~~~~~l~~Ia~k~g~t~AQv~L~W~i~~gv~~Ipks~ 235 (280)
T COG0656 162 NQIEYHPYLRQPELLPFCQRHGIAVEAYSPLAK-GG-----KLLDNPVLAEIAKKYGKTPAQVALRWHIQRGVIVIPKST 235 (280)
T ss_pred EEEEeccCCCcHHHHHHHHHcCCEEEEECCccc-cc-----ccccChHHHHHHHHhCCCHHHHHHHHHHhCCcEEecCCC
Confidence 999999999999999999999999999999996 32 167789999999999999999999999999999999999
Q ss_pred CHHHHHHhhccccccCCHHHHHHHhccCCCCCC
Q 039732 161 NKERLKENLDIFDWALTDHDYDKINQIPQHRMM 193 (214)
Q Consensus 161 ~~~~l~enl~a~~~~L~~~~~~~l~~~~~~~~~ 193 (214)
+++|++||++++++.||++|+++|+++......
T Consensus 236 ~~~ri~eN~~~~~f~Ls~ed~~~i~~l~~~~~~ 268 (280)
T COG0656 236 TPERIRENLAAFDFELSEEDMAAIDALDRGYGR 268 (280)
T ss_pred CHHHHHHHHhhhcCCCCHHHHHHHHhhccccCc
Confidence 999999999999999999999999999987654
|
|
| >KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK10625 tas putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] | Back alignment and domain information |
|---|
| >cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >PRK10376 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02587 L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >PRK14863 bifunctional regulator KidO; Provisional | Back alignment and domain information |
|---|
| >COG4989 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase | Back alignment and domain information |
|---|
| >TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase | Back alignment and domain information |
|---|
| >TIGR01228 hutU urocanate hydratase | Back alignment and domain information |
|---|
| >PRK05414 urocanate hydratase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 214 | ||||
| 1zgd_A | 312 | Chalcone Reductase Complexed With Nadp+ At 1.7 Angs | 2e-60 | ||
| 3h7u_A | 335 | Crystal Structure Of The Plant Stress-Response Enzy | 2e-50 | ||
| 3h7r_A | 331 | Crystal Structure Of The Plant Stress-Response Enzy | 9e-48 | ||
| 2bgq_A | 344 | Apo Aldose Reductase From Barley Length = 344 | 2e-36 | ||
| 2ipj_A | 321 | Crystal Structure Of H3alpha-Hydroxysteroid Dehydro | 1e-35 | ||
| 1j96_A | 323 | Human 3alpha-Hsd Type 3 In Ternary Complex With Nad | 1e-35 | ||
| 1xjb_A | 325 | Crystal Structure Of Human Type 3 3alpha-Hydroxyste | 1e-35 | ||
| 1ihi_A | 323 | Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy | 2e-35 | ||
| 3c3u_A | 323 | Crystal Structure Of Akr1c1 In Complex With Nadp An | 2e-35 | ||
| 1mrq_A | 323 | Crystal Structure Of Human 20alpha-hsd In Ternary C | 2e-35 | ||
| 3gug_A | 323 | Crystal Structure Of Akr1c1 L308v Mutant In Complex | 2e-35 | ||
| 3uzw_A | 346 | Crystal Structure Of 5beta-Reductase (Akr1d1) E120h | 2e-33 | ||
| 3uwe_A | 331 | Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length | 4e-33 | ||
| 3o0k_A | 283 | Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL | 5e-33 | ||
| 3r43_A | 331 | Akr1c3 Complexed With Mefenamic Acid Length = 331 | 6e-33 | ||
| 1s1p_A | 331 | Crystal Structures Of Prostaglandin D2 11-Ketoreduc | 6e-33 | ||
| 1ry0_A | 323 | Structure Of Prostaglandin F Synthase With Prostagl | 6e-33 | ||
| 2fvl_A | 324 | Crystal Structure Of Human 3-alpha Hydroxysteroid/d | 9e-33 | ||
| 3cmf_A | 346 | Crystal Structure Of Human Liver 5beta-Reductase (A | 2e-32 | ||
| 3bur_A | 326 | Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta- | 2e-32 | ||
| 1q13_A | 323 | Crystal Structure Of Rabbit 20alpha Hyroxysteroid D | 3e-32 | ||
| 1q5m_A | 322 | Binary Complex Of Rabbit 20alpha-Hydroxysteroid Deh | 3e-32 | ||
| 4fzi_A | 290 | Crystal Structure Of Prostaglandin F Synthase From | 3e-32 | ||
| 1vbj_A | 281 | The Crystal Structure Of Prostaglandin F Synthase F | 1e-31 | ||
| 1zua_X | 317 | Crystal Structure Of Akr1b10 Complexed With Nadp+ A | 2e-31 | ||
| 3fjn_A | 323 | The Crystal Structure Of 17-Alpha Hydroxysteroid De | 3e-31 | ||
| 2wzm_A | 283 | Crystal Structure Of A Mycobacterium Aldo-Keto Redu | 4e-31 | ||
| 1vp5_A | 298 | Crystal Structure Of 2,5-diketo-d-gluconic Acid Red | 4e-31 | ||
| 2he5_A | 323 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 4e-31 | ||
| 2ipf_A | 318 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 5e-31 | ||
| 2ipg_A | 319 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 5e-31 | ||
| 3f7j_A | 276 | B.Subtilis Yvgn Length = 276 | 9e-31 | ||
| 3d3f_A | 275 | Crystal Structure Of Yvgn And Cofactor Nadph From B | 1e-30 | ||
| 3cv6_A | 323 | The Crystal Structure Of Mouse 17-Alpha Hydroxyster | 1e-30 | ||
| 4f40_A | 288 | X-Ray Crystal Structure Of Apo Prostaglandin F Synt | 2e-30 | ||
| 1hw6_A | 278 | Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red | 2e-30 | ||
| 1a80_A | 277 | Native 2,5-Diketo-D-Gluconic Acid Reductase A From | 2e-30 | ||
| 1dla_A | 314 | Novel Nadph-Binding Domain Revealed By The Crystal | 7e-30 | ||
| 1eko_A | 315 | Pig Aldose Reductase Complexed With Idd384 Inhibito | 7e-30 | ||
| 1ah0_A | 316 | Pig Aldose Reductase Complexed With Sorbinil Length | 7e-30 | ||
| 3lz5_A | 316 | Human Aldose Reductase Mutant T113v Complexed With | 3e-29 | ||
| 1m9h_A | 278 | Corynebacterium 2,5-dkgr A And Phe 22 Replaced With | 4e-29 | ||
| 1mzr_A | 296 | Structure Of Dkga From E.Coli At 2.13 A Resolution | 6e-29 | ||
| 2pdx_A | 316 | Human Aldose Reductase Double Mutant S302r-C303d Co | 6e-29 | ||
| 2pdq_A | 316 | Human Aldose Reductase Mutant C303d Complexed With | 6e-29 | ||
| 2pdf_A | 316 | Human Aldose Reductase Mutant L300p Complexed With | 7e-29 | ||
| 2r24_A | 316 | Human Aldose Reductase Structure Length = 316 | 7e-29 | ||
| 1ef3_A | 315 | Fidarestat Bound To Human Aldose Reductase Length = | 7e-29 | ||
| 1abn_A | 315 | The Crystal Structure Of The Aldose Reductase Nadph | 7e-29 | ||
| 2agt_A | 319 | Aldose Reductase Mutant Leu 300 Pro Complexed With | 7e-29 | ||
| 3rx2_A | 336 | Crystal Structure Of Human Aldose Reductase Complex | 7e-29 | ||
| 2pdm_A | 316 | Human Aldose Reductase Mutant S302r Complexed With | 7e-29 | ||
| 1el3_A | 316 | Human Aldose Reductase Complexed With Idd384 Inhibi | 7e-29 | ||
| 2acu_A | 315 | Tyrosine-48 Is The Proton Donor And Histidine-110 D | 7e-29 | ||
| 3q67_A | 316 | Human Aldose Reductase C298s Mutant In Complex With | 7e-29 | ||
| 1z3n_A | 319 | Human Aldose Reductase In Complex With Nadp+ And Th | 7e-29 | ||
| 2pdk_A | 316 | Human Aldose Reductase Mutant L301m Complexed With | 7e-29 | ||
| 2pd5_A | 316 | Human Aldose Reductase Mutant V47i Complexed With Z | 7e-29 | ||
| 2pdi_A | 316 | Human Aldose Reductase Mutant L300a Complexed With | 8e-29 | ||
| 1pwl_A | 316 | Crystal Structure Of Human Aldose Reductase Complex | 8e-29 | ||
| 3lbo_A | 316 | Human Aldose Reductase Mutant T113c Complexed With | 8e-29 | ||
| 3onb_A | 315 | Bond Breakage And Relocation Of A Covalently Bound | 9e-29 | ||
| 3lqg_A | 316 | Human Aldose Reductase Mutant T113a Complexed With | 9e-29 | ||
| 4gac_A | 324 | High Resolution Structure Of Mouse Aldehyde Reducta | 9e-29 | ||
| 2is7_A | 315 | Crystal Structure Of Aldose Reductase Complexed Wit | 1e-28 | ||
| 3ld5_A | 316 | Human Aldose Reductase Mutant T113s Complexed With | 1e-28 | ||
| 2pdb_A | 316 | Human Aldose Reductase Mutant F121p Complexed With | 2e-28 | ||
| 2ipw_A | 315 | Crystal Structure Of C298a W219y Aldose Reductase C | 3e-28 | ||
| 1xgd_A | 315 | Apo R268a Human Aldose Reductase Length = 315 | 5e-28 | ||
| 1cwn_A | 324 | Crystal Structure Of Porcine Aldehyde Reductase Hol | 1e-27 | ||
| 1hqt_A | 326 | The Crystal Structure Of An Aldehyde Reductase Y50f | 1e-27 | ||
| 1ae4_A | 325 | Aldehyde Reductase Complexed With Cofactor And Inhi | 1e-27 | ||
| 2alr_A | 324 | Aldehyde Reductase Length = 324 | 1e-27 | ||
| 1lwi_A | 322 | 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO | 2e-27 | ||
| 1afs_A | 323 | Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr | 2e-27 | ||
| 3cv7_A | 325 | Crystal Structure Of Porcine Aldehyde Reductase Ter | 2e-27 | ||
| 1c9w_A | 315 | Cho Reductase With Nadp+ Length = 315 | 3e-27 | ||
| 1ral_A | 308 | Three-Dimensional Structure Of Rat Liver 3alpha- Hy | 7e-27 | ||
| 3ln3_A | 324 | Crystal Structure Of Putative Reductase (Np_038806. | 1e-25 | ||
| 1frb_A | 315 | Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 | 2e-25 | ||
| 3b3d_A | 314 | B.Subtilis Ytbe Length = 314 | 2e-25 | ||
| 3qkz_A | 316 | Crystal Structure Of Mutant His269arg Akr1b14 Lengt | 1e-24 | ||
| 1qwk_A | 317 | Structural Genomics Of Caenorhabditis Elegans: Hypo | 5e-24 | ||
| 3o3r_A | 316 | Crystal Structure Of Akr1b14 In Complex With Nadp L | 6e-24 | ||
| 3krb_A | 334 | Structure Of Aldose Reductase From Giardia Lamblia | 1e-23 | ||
| 1jez_A | 322 | The Structure Of Xylose Reductase, A Dimeric Aldo-K | 1e-23 | ||
| 1z9a_A | 321 | Crystal Structure Of The Asn-309 To Asp Mutant Of C | 1e-23 | ||
| 1ye4_A | 322 | Crystal Structure Of The Lys-274 To Arg Mutant Of C | 2e-23 | ||
| 1sm9_A | 322 | Crystal Structure Of An Engineered K274rn276d Doubl | 3e-23 | ||
| 1r38_A | 322 | Crystal Structure Of H114a Mutant Of Candida Tenuis | 2e-22 | ||
| 3up8_A | 298 | Crystal Structure Of A Putative 2,5-Diketo-D-Glucon | 2e-21 | ||
| 3n2t_A | 348 | Structure Of The Glycerol Dehydrogenase Akr11b4 Fro | 9e-08 | ||
| 1pz1_A | 333 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 6e-06 | ||
| 3v0u_A | 338 | Crystal Structure Of Perakine Reductase, Founder Me | 2e-04 | ||
| 3v0t_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 2e-04 | ||
| 3uyi_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 5e-04 |
| >pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 | Back alignment and structure |
|
| >pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 | Back alignment and structure |
| >pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 | Back alignment and structure |
| >pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 | Back alignment and structure |
| >pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 | Back alignment and structure |
| >pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 | Back alignment and structure |
| >pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 | Back alignment and structure |
| >pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 | Back alignment and structure |
| >pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 | Back alignment and structure |
| >pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 | Back alignment and structure |
| >pdb|3UZW|A Chain A, Crystal Structure Of 5beta-Reductase (Akr1d1) E120h Mutant In Complex With Nadp+ Length = 346 | Back alignment and structure |
| >pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 | Back alignment and structure |
| >pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 | Back alignment and structure |
| >pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 | Back alignment and structure |
| >pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 | Back alignment and structure |
| >pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 | Back alignment and structure |
| >pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 | Back alignment and structure |
| >pdb|3CMF|A Chain A, Crystal Structure Of Human Liver 5beta-Reductase (Akr1d1) In Complex With Nadp And Cortisone. Resolution 1.90 A. Length = 346 | Back alignment and structure |
| >pdb|3BUR|A Chain A, Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta-Reductase In Complex With Nadp And Testosterone. Resolution: 1.62 A. Length = 326 | Back alignment and structure |
| >pdb|1Q13|A Chain A, Crystal Structure Of Rabbit 20alpha Hyroxysteroid Dehydrogenase In Ternary Complex With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|1Q5M|A Chain A, Binary Complex Of Rabbit 20alpha-Hydroxysteroid Dehydrogenase With Nadph Length = 322 | Back alignment and structure |
| >pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 | Back alignment and structure |
| >pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 | Back alignment and structure |
| >pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 | Back alignment and structure |
| >pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 | Back alignment and structure |
| >pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 | Back alignment and structure |
| >pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 | Back alignment and structure |
| >pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 | Back alignment and structure |
| >pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 | Back alignment and structure |
| >pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 | Back alignment and structure |
| >pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 | Back alignment and structure |
| >pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 | Back alignment and structure |
| >pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 | Back alignment and structure |
| >pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 | Back alignment and structure |
| >pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 | Back alignment and structure |
| >pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 | Back alignment and structure |
| >pdb|1DLA|A Chain A, Novel Nadph-Binding Domain Revealed By The Crystal Structure Of Aldose Reductase Length = 314 | Back alignment and structure |
| >pdb|1EKO|A Chain A, Pig Aldose Reductase Complexed With Idd384 Inhibitor Length = 315 | Back alignment and structure |
| >pdb|1AH0|A Chain A, Pig Aldose Reductase Complexed With Sorbinil Length = 316 | Back alignment and structure |
| >pdb|3LZ5|A Chain A, Human Aldose Reductase Mutant T113v Complexed With Idd594 Length = 316 | Back alignment and structure |
| >pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 | Back alignment and structure |
| >pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 | Back alignment and structure |
| >pdb|2PDX|A Chain A, Human Aldose Reductase Double Mutant S302r-C303d Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|2PDQ|A Chain A, Human Aldose Reductase Mutant C303d Complexed With Uracil- Type Inhibitor. Length = 316 | Back alignment and structure |
| >pdb|2PDF|A Chain A, Human Aldose Reductase Mutant L300p Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|2R24|A Chain A, Human Aldose Reductase Structure Length = 316 | Back alignment and structure |
| >pdb|1EF3|A Chain A, Fidarestat Bound To Human Aldose Reductase Length = 315 | Back alignment and structure |
| >pdb|1ABN|A Chain A, The Crystal Structure Of The Aldose Reductase Nadph Binary Complex Length = 315 | Back alignment and structure |
| >pdb|2AGT|A Chain A, Aldose Reductase Mutant Leu 300 Pro Complexed With Fidarestat Length = 319 | Back alignment and structure |
| >pdb|3RX2|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Sulindac Sulfone Length = 336 | Back alignment and structure |
| >pdb|2PDM|A Chain A, Human Aldose Reductase Mutant S302r Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|1EL3|A Chain A, Human Aldose Reductase Complexed With Idd384 Inhibitor Length = 316 | Back alignment and structure |
| >pdb|2ACU|A Chain A, Tyrosine-48 Is The Proton Donor And Histidine-110 Directs Substrate Stereochemical Selectivity In The Reduction Reaction Of Human Aldose Reductase: Enzyme Kinetics And The Crystal Structure Of The Y48h Mutant Enzyme Length = 315 | Back alignment and structure |
| >pdb|3Q67|A Chain A, Human Aldose Reductase C298s Mutant In Complex With Nadp+ In Space Group P212121 Length = 316 | Back alignment and structure |
| >pdb|1Z3N|A Chain A, Human Aldose Reductase In Complex With Nadp+ And The Inhibitor Lidorestat At 1.04 Angstrom Length = 319 | Back alignment and structure |
| >pdb|2PDK|A Chain A, Human Aldose Reductase Mutant L301m Complexed With Sorbinil. Length = 316 | Back alignment and structure |
| >pdb|2PD5|A Chain A, Human Aldose Reductase Mutant V47i Complexed With Zopolrestat Length = 316 | Back alignment and structure |
| >pdb|2PDI|A Chain A, Human Aldose Reductase Mutant L300a Complexed With Zopolrestat At 1.55 A. Length = 316 | Back alignment and structure |
| >pdb|1PWL|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Nadp And Minalrestat Length = 316 | Back alignment and structure |
| >pdb|3LBO|A Chain A, Human Aldose Reductase Mutant T113c Complexed With Idd594 Length = 316 | Back alignment and structure |
| >pdb|3ONB|A Chain A, Bond Breakage And Relocation Of A Covalently Bound Bromine Of Idd594 In A Complex With Har T113a Mutant After Extensive Radiation Dose Length = 315 | Back alignment and structure |
| >pdb|3LQG|A Chain A, Human Aldose Reductase Mutant T113a Complexed With Idd388 Length = 316 | Back alignment and structure |
| >pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 | Back alignment and structure |
| >pdb|2IS7|A Chain A, Crystal Structure Of Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 | Back alignment and structure |
| >pdb|3LD5|A Chain A, Human Aldose Reductase Mutant T113s Complexed With Idd594 Length = 316 | Back alignment and structure |
| >pdb|2PDB|A Chain A, Human Aldose Reductase Mutant F121p Complexed With Zopolrestat. Length = 316 | Back alignment and structure |
| >pdb|2IPW|A Chain A, Crystal Structure Of C298a W219y Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 | Back alignment and structure |
| >pdb|1XGD|A Chain A, Apo R268a Human Aldose Reductase Length = 315 | Back alignment and structure |
| >pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 | Back alignment and structure |
| >pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 | Back alignment and structure |
| >pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 | Back alignment and structure |
| >pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 | Back alignment and structure |
| >pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 | Back alignment and structure |
| >pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 | Back alignment and structure |
| >pdb|1C9W|A Chain A, Cho Reductase With Nadp+ Length = 315 | Back alignment and structure |
| >pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 | Back alignment and structure |
| >pdb|3LN3|A Chain A, Crystal Structure Of Putative Reductase (Np_038806.2) From Mus Musculus At 1.18 A Resolution Length = 324 | Back alignment and structure |
| >pdb|1FRB|A Chain A, Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 | Back alignment and structure |
| >pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 | Back alignment and structure |
| >pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 | Back alignment and structure |
| >pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 | Back alignment and structure |
| >pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 | Back alignment and structure |
| >pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 | Back alignment and structure |
| >pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 | Back alignment and structure |
| >pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 | Back alignment and structure |
| >pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 | Back alignment and structure |
| >pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 | Back alignment and structure |
| >pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 | Back alignment and structure |
| >pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 | Back alignment and structure |
| >pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 | Back alignment and structure |
| >pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 | Back alignment and structure |
| >pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 | Back alignment and structure |
| >pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 1e-118 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 1e-116 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 1e-108 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 1e-107 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 5e-96 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 7e-95 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 4e-92 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 6e-90 | |
| 2ao0_A | 324 | Aldehyde dehydrogenase; TIM barrel, aldo-keto redu | 7e-90 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 1e-89 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 5e-89 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 5e-86 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 3e-85 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 1e-74 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 1e-74 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 4e-74 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 1e-73 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 2e-73 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 5e-73 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 5e-73 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 1e-72 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 5e-72 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 5e-72 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 3e-70 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 2e-65 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 1e-27 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 1e-26 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 1e-25 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 4e-24 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 1e-19 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 2e-17 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 1e-16 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 1e-15 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 1e-15 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 4e-15 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 6e-15 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 7e-14 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 1e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-06 |
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 | Back alignment and structure |
|---|
Score = 338 bits (868), Expect = e-118
Identities = 94/214 (43%), Positives = 141/214 (65%), Gaps = 4/214 (1%)
Query: 2 LQMDYVDLYLIHWPISAKPSEKLQSLIPKEDLVPLDYKGVWEAMEECQRLGLTKFIGVSN 61
LQ++YVDLYLIHWP K I E+L+P+D W+AME G + IGVSN
Sbjct: 123 LQLEYVDLYLIHWPARIKKGS---VGIKPENLLPVDIPSTWKAMEALYDSGKARAIGVSN 179
Query: 62 FSSKKIEALLAFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSWGTN 121
FS+KK+ LL + +PP+VNQVE +P+W+Q +L+EFCKSK + ++A+SPLG+ G++W +
Sbjct: 180 FSTKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSKGVHLSAYSPLGSPGTTWLKS 239
Query: 122 QVMNNEALKQIADAHGKTVAQVCLRWIIEQGAIVVAKSFNKERLKENLDIFDWALTDHDY 181
V+ N L +A+ GK+ AQV LRW ++ G V+ KS N+ R+KEN ++FDW++ D+ +
Sbjct: 240 DVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSVLPKSTNEGRIKENFNVFDWSIPDYMF 299
Query: 182 DKINQIPQHRMMPRDEYIT-PHGPFKTLEELWDE 214
K +I Q R++ + P+K++EELWD
Sbjct: 300 AKFAEIEQARLVTGSFLVHETLSPYKSIEELWDG 333
|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 | Back alignment and structure |
|---|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 | Back alignment and structure |
|---|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 100.0 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 100.0 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 100.0 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 100.0 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 100.0 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 100.0 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 100.0 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 100.0 | |
| 4gac_A | 324 | Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe | 100.0 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 100.0 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 100.0 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 100.0 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 100.0 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 100.0 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 100.0 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 100.0 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 100.0 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 100.0 | |
| 3b3d_A | 314 | YTBE protein, putative morphine dehydrogenase; ald | 100.0 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 100.0 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 100.0 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 100.0 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 100.0 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 100.0 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 100.0 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 100.0 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 100.0 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 100.0 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 100.0 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 100.0 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 100.0 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 100.0 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 100.0 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 100.0 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 100.0 | |
| 4exb_A | 292 | Putative uncharacterized protein; aldo-keto reduct | 100.0 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 98.27 |
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.8e-45 Score=309.22 Aligned_cols=211 Identities=44% Similarity=0.851 Sum_probs=184.3
Q ss_pred CCCCCeeeEEEEecCCCCCCCcccccCCCcCCCCCCCHHHHHHHHHHHHHcCCccEEEecCCCHHHHHHHHhcCCCCCee
Q 039732 1 TLQMDYVDLYLIHWPISAKPSEKLQSLIPKEDLVPLDYKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALLAFSTIPPSV 80 (214)
Q Consensus 1 rL~tdyiDl~~lH~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~l~~l~~~Gkir~iGiS~~~~~~l~~~~~~~~~~~~~ 80 (214)
||||||||+|++|||+...++. .+| ..+.......+++|++|++|+++||||+||||||+++.++++++.++++|++
T Consensus 122 rLg~dyiDl~llH~p~~~~~~~--~~~-~~~~~~~~~~~e~~~aL~~l~~~Gkir~iGvSn~~~~~l~~~~~~~~~~~~~ 198 (335)
T 3h7u_A 122 DLQLEYVDLYLIHWPARIKKGS--VGI-KPENLLPVDIPSTWKAMEALYDSGKARAIGVSNFSTKKLADLLELARVPPAV 198 (335)
T ss_dssp HHTCSCBSEEEECSSCEECSSC--SSC-CGGGEECCCHHHHHHHHHHHHHTTSBSSEEEESCCHHHHHHHHHHCSSCCSE
T ss_pred HcCCCceeEEEEcCCCcccccc--ccc-cccccccCCHHHHHHHHHHHHHcCCccEEEecCCCHHHHHHHHHhCCCCeEE
Confidence 6899999999999997544321 111 1111113458999999999999999999999999999999999999889999
Q ss_pred eecccCcccchHHHHHHHHhCCCeEEEeccCCCCCCCCCCCCCCChHHHHHHHHHhCCCHHHHHHHHHhhcCcEEeeCCC
Q 039732 81 NQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSWGTNQVMNNEALKQIADAHGKTVAQVCLRWIIEQGAIVVAKSF 160 (214)
Q Consensus 81 ~q~~~~~~~~~~~~~~~~~~~gi~vi~~~~l~~~G~L~~~~~~~~~~~l~~~a~~~~~s~~q~al~~~l~~~~~vl~g~~ 160 (214)
+|++||++.++.+++++|+++||++++|+||++.|..++....+..+.+.++|+++|+|++|+||+|++++++++|+|++
T Consensus 199 ~Q~~~~~~~~~~~l~~~~~~~gI~v~a~sPL~~g~~~~~~~~~~~~~~l~~iA~~~g~t~aqvaL~w~l~~~~~vI~g~~ 278 (335)
T 3h7u_A 199 NQVECHPSWRQTKLQEFCKSKGVHLSAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSVLPKST 278 (335)
T ss_dssp EEEECBTTBCCHHHHHHHHHHTCEEEEESTTCCTTCTTSCCCGGGCHHHHHHHHHHTCCHHHHHHHHHHHTTCEECCBCS
T ss_pred EecccccccCCHHHHHHHHHCCCEEEEeccCcCCCCCCCCccccccHHHHHHHHHHCcCHHHHHHHHHHHCCCEEEeCCC
Confidence 99999999999999999999999999999999734444555566779999999999999999999999999999999999
Q ss_pred CHHHHHHhhccccccCCHHHHHHHhccCCCCCCCCCcccCCC-CCcccchhcccC
Q 039732 161 NKERLKENLDIFDWALTDHDYDKINQIPQHRMMPRDEYITPH-GPFKTLEELWDE 214 (214)
Q Consensus 161 ~~~~l~enl~a~~~~L~~~~~~~l~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~ 214 (214)
|++||++|+++++++|++++++.|+++.......+..|.++. +||++++++||+
T Consensus 279 ~~~~l~enl~a~~~~L~~e~~~~i~~l~~~~~~~~~~~~~~~~~p~~~~~~~~~~ 333 (335)
T 3h7u_A 279 NEGRIKENFNVFDWSIPDYMFAKFAEIEQARLVTGSFLVHETLSPYKSIEELWDG 333 (335)
T ss_dssp CHHHHHHHHCCSSCCCCHHHHHHGGGSCCCCSCCCGGGBCTTTSSBSSHHHHTTT
T ss_pred CHHHHHHHHhhCCCCcCHHHHHHHHhHhhcCccccceeccCCCCCcccccccccc
Confidence 999999999999999999999999999998888887777554 899999999985
|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... | Back alignment and structure |
|---|
| >4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} | Back alignment and structure |
|---|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* | Back alignment and structure |
|---|
| >4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 214 | ||||
| d1us0a_ | 314 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 7e-40 | |
| d1s1pa_ | 315 | c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak | 2e-38 | |
| d1afsa_ | 319 | c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase | 8e-33 | |
| d1mi3a_ | 319 | c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu | 2e-32 | |
| d1mzra_ | 274 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 3e-31 | |
| d1frba_ | 315 | c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce | 4e-30 | |
| d1hqta_ | 324 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 6e-29 | |
| d1qwka_ | 312 | c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod | 2e-27 | |
| d1lqaa_ | 346 | c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: | 2e-26 | |
| d1vp5a_ | 284 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 3e-25 | |
| d1hw6a_ | 262 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 2e-23 | |
| d1pyfa_ | 311 | c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu | 2e-19 | |
| d1ur3m_ | 298 | c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc | 2e-14 | |
| d1pz1a_ | 333 | c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu | 3e-13 | |
| d3eaua1 | 326 | c.1.7.1 (A:36-361) Voltage-dependent K+ channel be | 3e-13 | |
| d1gvea_ | 324 | c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) | 5e-08 |
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Aldose reductase (aldehyde reductase) species: Human (Homo sapiens) [TaxId: 9606]
Score = 136 bits (343), Expect = 7e-40
Identities = 74/212 (34%), Positives = 117/212 (55%), Gaps = 9/212 (4%)
Query: 3 QMDYVDLYLIHWPISAKPSEKLQSLIPKEDLVPL--DYKGVWEAMEECQRLGLTKFIGVS 60
++DY+DLYLIHWP KP ++ L ++VP + W AMEE GL K IG+S
Sbjct: 101 KLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGIS 160
Query: 61 NFSSKKIEALL--AFSTIPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSW 118
NF+ ++E +L P+VNQ+E +P Q +L ++C+SK I+VTA+SPLG+ W
Sbjct: 161 NFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPW 220
Query: 119 GTNQ---VMNNEALKQIADAHGKTVAQVCLRWIIEQGAIVVAKSFNKERLKENLDIFDWA 175
+ ++ + +K IA H KT AQV +R+ +++ +V+ KS ER+ EN +FD+
Sbjct: 221 AKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFE 280
Query: 176 LTDHDYDKINQIPQ-HRMMPRDEYIT-PHGPF 205
L+ D + + R+ + PF
Sbjct: 281 LSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF 312
|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 | Back information, alignment and structure |
|---|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 | Back information, alignment and structure |
|---|
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 | Back information, alignment and structure |
|---|
| >d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 324 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| d1afsa_ | 319 | 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus | 100.0 | |
| d1s1pa_ | 315 | Prostaglandin d2 11-ketoreductase (akr1c3) {Human | 100.0 | |
| d1us0a_ | 314 | Aldose reductase (aldehyde reductase) {Human (Homo | 100.0 | |
| d1qwka_ | 312 | Hypothetical protein C07D8.6 {Nematode (Caenorhabd | 100.0 | |
| d1lqaa_ | 346 | Tas protein {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1mzra_ | 274 | 2,5-diketo-D-gluconic acid reductase A {Escherichi | 100.0 | |
| d1hw6a_ | 262 | 2,5-diketo-D-gluconic acid reductase A {Corynebact | 100.0 | |
| d1mi3a_ | 319 | Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 | 100.0 | |
| d1hqta_ | 324 | Aldose reductase (aldehyde reductase) {Pig (Sus sc | 100.0 | |
| d1frba_ | 315 | FR-1 (fibroblast growth factor-induced) protein {M | 100.0 | |
| d1gvea_ | 324 | Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus | 100.0 | |
| d1pyfa_ | 311 | Putative oxidoreductase IolS {Bacillus subtilis [T | 100.0 | |
| d1vp5a_ | 284 | 2,5-diketo-D-gluconic acid reductase A {Thermotoga | 100.0 | |
| d1pz1a_ | 333 | Putative oxidoreductase YhdN {Bacillus subtilis [T | 100.0 | |
| d1ur3m_ | 298 | Hypothetical oxidoreductase YdhF {Escherichia coli | 100.0 | |
| d3eaua1 | 326 | Voltage-dependent K+ channel beta subunit {Rat (Ra | 99.98 | |
| d1dxea_ | 253 | 2-dehydro-3-deoxy-galactarate aldolase {Escherichi | 94.87 | |
| d1x87a_ | 545 | Urocanate hydratase HutU {Bacillus stearothermophi | 83.25 | |
| d1uwka_ | 554 | Urocanate hydratase HutU {Pseudomonas putida [TaxI | 80.92 |
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: 3-alpha-hydroxysteroid dehydrogenase species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00 E-value=1.6e-38 Score=265.29 Aligned_cols=200 Identities=32% Similarity=0.561 Sum_probs=168.9
Q ss_pred CCCCCeeeEEEEecCCCCCCCcccccCCCc---CCCCCCCHHHHHHHHHHHHHcCCccEEEecCCCHHHHHHHHhcCC--
Q 039732 1 TLQMDYVDLYLIHWPISAKPSEKLQSLIPK---EDLVPLDYKGVWEAMEECQRLGLTKFIGVSNFSSKKIEALLAFST-- 75 (214)
Q Consensus 1 rL~tdyiDl~~lH~~~~~~~~~~~~~~~~~---~~~~~~~~~e~~~~l~~l~~~Gkir~iGiS~~~~~~l~~~~~~~~-- 75 (214)
||||||||+|++|+|+...+... .+..+. ........++++++|++|+++||||+||+||++.+.+.++++.+.
T Consensus 105 rL~~d~iDl~~lH~p~~~~~~~~-~~~~~~~~~~~~~~~~~~e~~~~l~~l~~~Gkir~iGvSn~~~~~~~~~~~~~~~~ 183 (319)
T d1afsa_ 105 STQLDYVDLYIIHFPMALQPGDI-FFPRDEHGKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLK 183 (319)
T ss_dssp HHCCSSEEEEEESCSCEECSSSS-SSCBCTTCCBCEECCCHHHHHHHHHHHHHTTSEEEEEEESCCHHHHHHHHTCTTCC
T ss_pred hcCCcccceeEeccccCCCCCcc-ccCccccccccccCCCHHHHHHHHHHHHHcCCEEEEeeccccHHHHHHHHHhhccc
Confidence 68999999999999976554321 000000 011245589999999999999999999999999999999988775
Q ss_pred CCCeeeecccCcccchHHHHHHHHhCCCeEEEeccCCCCCCCCCCC-----CCCChHHHHHHHHHhCCCHHHHHHHHHhh
Q 039732 76 IPPSVNQVEMNPAWQQRQLREFCKSKSIIVTAFSPLGAAGSSWGTN-----QVMNNEALKQIADAHGKTVAQVCLRWIIE 150 (214)
Q Consensus 76 ~~~~~~q~~~~~~~~~~~~~~~~~~~gi~vi~~~~l~~~G~L~~~~-----~~~~~~~l~~~a~~~~~s~~q~al~~~l~ 150 (214)
+.+.++|+.+++...+.+++++|+++||++++|+||++ |.+.... .....+.+.++++++|+|++|+||+|+++
T Consensus 184 ~~~~~~~~~~~~~~~~~~ll~~~~~~~i~i~a~spl~~-G~~~~~~~~~~~~~~~~~~~~~la~~~g~s~aqlAL~w~l~ 262 (319)
T d1afsa_ 184 YKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGS-SRDKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQ 262 (319)
T ss_dssp SCCSEEEEECBTTBCCHHHHHHHHHHTCEEEEESTTSC-CCCTTTSCTTSCCGGGCHHHHHHHHHTTCCHHHHHHHHHHH
T ss_pred ccccccccchhhccchHHHhHHHHHcCceecccccccc-ccccCccCcCCchhhhHHHHHHHHHHHCCCHHHHHHHHHHH
Confidence 44677788888887789999999999999999999998 9876432 23445889999999999999999999999
Q ss_pred cCcEEeeCCCCHHHHHHhhccccccCCHHHHHHHhccCCCCCCCCCcccCCC
Q 039732 151 QGAIVVAKSFNKERLKENLDIFDWALTDHDYDKINQIPQHRMMPRDEYITPH 202 (214)
Q Consensus 151 ~~~~vl~g~~~~~~l~enl~a~~~~L~~~~~~~l~~~~~~~~~~~~~~~~~~ 202 (214)
++.++|+|++|++||++|+++.+++||++|++.|+++.++.|+..+.|+..+
T Consensus 263 ~~~~~I~G~~~~~~l~en~~a~~~~Ls~~e~~~L~~l~~~~r~~~~~~~~~~ 314 (319)
T d1afsa_ 263 RGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYFDDH 314 (319)
T ss_dssp TTCEEEECCSCHHHHHHHTTTTSCCCCHHHHHHHHTTCCCCCSCCCGGGTTC
T ss_pred CCCEEEECCCCHHHHHHHHHhCCCCCCHHHHHHHhCcCCCCCCCCchhccCC
Confidence 9988999999999999999999999999999999999999999998997444
|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x87a_ e.51.1.1 (A:) Urocanate hydratase HutU {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uwka_ e.51.1.1 (A:) Urocanate hydratase HutU {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|