Citrus Sinensis ID: 039784


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MKLALVTFLLVSLVLTSTFFEVSMAGSDFCDSKCAVRCSKAGREDRCLKYCGICCDKCHCVPSGTYGHKDECPCYRDLKNSKGKPKCP
cHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccccccccccccccc
**LALVTFLLVSLVLTSTFFEVSMAGSDFCDSKCAVRCSKAGREDRCLKYCGICCDKCHCVPSGTYGHKDECPCYRDLKN********
xxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLALVTFLLVSLVLTSTFFEVSMAGSDFCDSKCAVRCSKAGREDRCLKYCGICCDKCHCVPSGTYGHKDECPCYRDLKNSKGKPKCP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Snakin-1 Has an antimicrobial activity. Causes a rapid aggregation of both Gram-positive and Gram-negative bacteria, but the antimicrobial activity is not correlated with the capacity to aggregate bacteria.probableQ948Z4
Gibberellin-regulated protein 10 Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.probableQ8LFM2
Peamaclein probableP86888

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted