Citrus Sinensis ID: 039800

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570------

METHPRNSSFSSCSAYLRALAHTPARVSRRALSVSTSYEEMSRVRAKSGSDMRKTLRWYDLVCFGIGGMVGAGVFVTTGRASRLNAGPAIVISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAFLTGSNLILEYVMSNAAVARGFASYFGTAIGVPTAKWRLKVDGLPDGFNEIDVLAVAVVLVITFVICYSTRDSSVVNMILTVLHILFIAFVILMGFWKDPKNPSGFFPYGAKGVFNGAAMVYLSYIGYDAVSTMAEEVKNPVKDIPIGVSGSVIIVTVLYCLMAASMSMLMPYDMIDAEAPFSGAFSGKSDGWKWVSNVIGVGASFGILTSLLVAMLGQARYMCVIGRSSVVPAWFARVHPKTSTPVNASAFLGIFTAAIALFTDLTVLLNLVSIGTLFVFYMVANAVIYRRYVNLGTTNPQPTLSFLFLFSVTSIIFTLIWHFVPPCKSKAFMLGASAIVAIAVLQIFHCVVPQAKKPEFWGVPLMPWIPCISIFLNIFLLGSLDGPSYVRFGFFSALAVLVYLLYSVHASFDAEEDGSFGQKSCESPKESAESEDPSLKV

ccccccccccccHHHHHHHHHccHHHHHccccccccHHHHHHHHHHcccccccccccHHHHHHHcccEEEcccEEEccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEECccccccccccccHHHHHHHcEEEEEEEEEHHHHcccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHEEEEEEccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHEEccccccccccccccccccccccccccccccccccc

***************YL*ALAHTPARVSRR***********************KTLRWYDLVCFGIGGMVGAGVFVTTGRASRLNAGPAIVISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAFLTGSNLILEYVMSNAAVARGFASYFGTAIGVPTAKWRLKVDGLPDGFNEIDVLAVAVVLVITFVICYSTRDSSVVNMILTVLHILFIAFVILMGFWKDPKNPSGFFPYGAKGVFNGAAMVYLSYIGYDAVSTMAEEVKNPVKDIPIGVSGSVIIVTVLYCLMAASMSMLMPYDMIDAEAPFSGAFSGKSDGWKWVSNVIGVGASFGILTSLLVAMLGQARYMCVIGRSSVVPAWFARVHPKTSTPVNASAFLGIFTAAIALFTDLTVLLNLVSIGTLFVFYMVANAVIYRRYVNLGTTNPQPTLSFLFLFSVTSIIFTLIWHFVPPCKSKAFMLGASAIVAIAVLQIFHCVVPQAKKPEFWGVPLMPWIPCISIFLNIFLLGSLDGPSYVRFGFFSALAVLVYLLYSVHASF*****************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHxHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cationic amino acid transporter 7, chloroplastic	Permease involved in the transport of the cationic amino acids.	confident	Q9SQZ0
Cationic amino acid transporter 6, chloroplastic	Permease involved in the transport of the cationic neutral or acidic amino acids.	probable	Q9LZ20

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:very confident
Coverage over the Query: 53-172,185-434,498-545
View the alignment between query and template
View the model in PyMOL

Template: 4DJK, chain A
Confidence level:very confident
Coverage over the Query: 55-437,459-491
View the alignment between query and template
View the model in PyMOL