Citrus Sinensis ID: 039874


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380--
CSSSSCYSENLVAAQKLVYEFNPQIPIEKALTPPSSWYTDPSFLALELHRVFYRSWQVVGYTDQLKDPQDFFSGRIGEVEFVVCRDDNGKIHAFHNVCRHHASILATGSGKKSWFVCPYHGWTYGLDGTLLKATRITGIKDFNVKEFGLVPLEVATWGPFVLLNMGKEAVHQEEVDSNVVANEWLGGSSEILSINGIDSSLSYLCRREYTIECNWKVFCDNYLDGGYHVPYAHKGLASGLQLDSYSTSLYEKVSIQRCESGSTEGTDDTHRLGSKAIYAFIYPNFMINRYGPWMDTNLVIPLAPTRCKVVFDYFLDGSLKDDKAFIEQSLKDSEQVQMEDIILCEGVQRGLESPAYCSGRYAPSVEQTMYHFHSLLHCNLTN
ccccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccccEEEEEcccccccccEEEEEEccCEEEEEEcccccEEEEEcccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccEEEEccEEEEEcccccccHHHccccHHHHHHcccHHHHHHccccccccEEEEEEEEEEccccHHHHHccccccccccccccccccccccccccccccccEEEECcccccccccccccccccEEEEEEEcccEEEECcccCEEEEEEEEccccCEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcc
********ENLVAAQKLVYEFNPQIPIEKALTPPSSWYTDPSFLALELHRVFYRSWQVVGYTDQLKDPQDFFSGRIGEVEFVVCRDDNGKIHAFHNVCRHHASILATGSGKKSWFVCPYHGWTYGLDGTLLKATRITGIKDFNVKEFGLVPLEVATWGPFVLLNMGKEAVHQEEVDSNVVANEWLGGSSEILSINGIDSSLSYLCRREYTIECNWKVFCDNYLDGGYHVPYAHKGLASGLQLDSYSTSLYEKVSIQR*************RLGSKAIYAFIYPNFMINRYGPWMDTNLVIPLAPTRCKVVFDYFLDGSLKDDKAFIEQSLKDSEQVQMEDIILCEGVQRGLESPAYCSGRYAPSVEQTMYHFHSLLHCNLTN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CSSSSCYSENLVAAQKLVYEFNPQIPIEKALTPPSSWYTDPSFLALELHRVFYRSWQVVGYTDQLKDPQDFFSGRIGEVEFVVCRDDNGKIHAFHNVCRHHASILATGSGKKSWFVCPYHGWTYGLDGTLLKATRITGIKDFNVKEFGLVPLEVATWGPFVLLNMGKEAVHQEEVDSNVVANEWLGGSSEILSINGIDSSLSYLCRREYTIECNWKVFCDNYLDGGYHVPYAHKGLASGLQLDSYSTSLYEKVSIQRCESGSTEGTDDTHRLGSKAIYAFIYPNFMINRYGPWMDTNLVIPLAPTRCKVVFDYFLDGSLKDDKAFIEQSLKDSEQVQMEDIILCEGVQRGLESPAYCSGRYAPSVEQTMYHFHSLLHCNLTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Choline monooxygenase, chloroplastic Catalyzes the first step of the osmoprotectant glycine betaine synthesis.probableQ9SZR0
Choline monooxygenase, chloroplastic Catalyzes the first step of the osmoprotectant glycine betaine synthesis.probableO22553
Choline monooxygenase, chloroplastic Catalyzes the first step of the osmoprotectant glycine betaine synthesis.probableQ93XE1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.15.-With a reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen.probable
1.14.15.7Transferred entry: 1.14.15.7.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B1X, chain A
Confidence level:very confident
Coverage over the Query: 30-381
View the alignment between query and template
View the model in PyMOL
Template: 2XSH, chain A
Confidence level:probable
Coverage over the Query: 20-229
View the alignment between query and template
View the model in PyMOL