Citrus Sinensis ID: 039893


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------
MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCGSH
cccccccccccccccCEEcccCEEEEEEEEccccEEEEEEEEHHHccccccccccccccccccCCccc
***T*GNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCGSH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Metallothionein-like protein 3A Metallothioneins have a high content of cysteine residues that bind various heavy metals.probableA1YTM8
Metallothionein-like protein type 3 Metallothioneins have a high content of cysteine residues that bind various heavy metals.probableO24059
Metallothionein-like protein 1 Metallothioneins have a high content of cysteine residues that bind various heavy metals.probableO48951

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QJL, chain A
Confidence level:probable
Coverage over the Query: 47-66
View the alignment between query and template
View the model in PyMOL