Citrus Sinensis ID: 039897

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--
MASGNQQFPPQKQEAQPGKEHVMEPTPQFTSHDYKPSNKLRGKVALVTGGDSGIGRAVAHCYALEGATVAFTYVKSQEEKDAQETLEILREAKTSDAKDPMAISADLGFDENCKRVVDEVVNAYGKIDILVNNAAVQYKAGSVEEIDEERLERVFRTNIFSHFFMTRHSLRHMNEGSAIINTTSVEPLWHSPEARGLALQLVERGIRVNGVAPGPIWTPLIPSSFSEEESAQFGSEVPMKRAGQPIEVAPCYVFLACNHCSSYITGQVLHPN
cccccccccccccccccccccccccccccccccccccccccccEEEECccccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHccccccccEEEEccccccHHHHHHHHHHHHHHHccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHcccccccccccccccHHHHHHHcccccccccccccccccc
**********************MEPTPQFTSHDYKPSNKLRGKVALVTGGDSGIGRAVAHCYALEGATVAFTYVKSQEEKDAQETLEILREAKTSDAKDPMAISADLGFDENCKRVVDEVVNAYGKIDILVNNAAVQYKAGSVEEIDEERLERVFRTNIFSHFFMTRHSLRHMNEGSAIINTTSVEPLWHSPEARGLALQLVERGIRVNGVAPGPIWTPLIPSSFSE*****FGSEVPMKRAGQPIEVAPCYVFLACNHCSSYITGQVLHPN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASGNQQFPPQKQEAQPGKEHVMEPTPQFTSHDYKPSNKLRGKVALVTGGDSGIGRAVAHCYALEGATVAFTYVKSQEEKDAQETLEILREAKTSDAKDPMAISADLGFDENCKRVVDEVVNAYGKIDILVNNAAVQYKAGSVEEIDEERLERVFRTNIFSHFFMTRHSLRHMNEGSAIINTTSVEPLWHSPEARGLALQLVERGIRVNGVAPGPIWTPLIPSSFSEEESAQFGSEVPMKRAGQPIEVAPCYVFLACNHCSSYITGQVLHPN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glucose and ribitol dehydrogenase homolog May act as a short alcohol-polyol-sugar dehydrogenase possibly related to carbohydrate metabolism and the acquisition of desiccation tolerance. May also be involved in signal transduction.probableQ75KH3
Glucose and ribitol dehydrogenase May act as a short alcohol-polyol-sugar dehydrogenase possibly related to carbohydrate metabolism and the acquisition of desiccation tolerance. May also be involved in signal transduction.probableQ5KTS5
3-oxoacyl-[acyl-carrier-protein] reductase FabG Catalyzes the NADPH-dependent reduction of beta-ketoacyl-ACP substrates to beta-hydroxyacyl-ACP products, the first reductive step in the elongation cycle of fatty acid biosynthesis.probableO67610

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IJR, chain A
Confidence level:very confident
Coverage over the Query: 9-272
View the alignment between query and template
View the model in PyMOL