Citrus Sinensis ID: 039926

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--

MPEKENSDVVVKEPRSVVRKFLARPQGEGMGAIVRRSIGRFELRYFDPFLVLDEFSVTAPAGFPDHPHRGFETVTYMLQGAVTHEDFEGHKGTIGPGDLQWMTAGRGIVHSEMPAAQGTQKGLQLWINLSSKYKMIEPRYQEVSSKDIAEAAKDGIKVRVIAGEALGVKSPIYTRTPTMYLDFTLKPGAHLRQPILRSWNAFVYVLEGEGLFGTVKSSPVSAHHLLLLGSGDGLEAWNKFSKPLRFVLVGGEPIGEPVAQLGPFVMNTQEEIDQTIDDFENYVNGFEKAKHWRSEAALALGF

ccccccccccccccEEEEEEEEcccccccccEEEEEcccccccccccccEEEccccccccccccccccccccEEEEEEEccEEcccccccccccccccHHHEEccccccccccccccccccEEEEEEEcccccccccccccccccccccEEEcccEEEEEEEEECcccccccccccccEEEEEEEccccEEEEEcccccEEEEEEEEccEEEccccccCCcccEEEEEEccccEEEEcccccccEEEEEcccccccccccccccccccHHHHHHHHHHHHcccccccccccccHHccccccc

***************SVVRKFLARPQGEGMGAIVRRSIGRFELRYFDPFLVLDEFSVTAPAGFPDHPHRGFETVTYMLQGAVTHEDFEGHKGTIGPGDLQWMTAGRGIVHSEMPAAQGTQKGLQLWINLSSKYKMIEPRYQEVSSKDIAEAAKDGIKVRVIAGEALGVKSPIYTRTPTMYLDFTLKPGAHLRQPILRSWNAFVYVLEGEGLFGTVKSSPVSAHHLLLLGSGDGLEAWNKFSKPLRFVLVGGEPIGEPVAQLGPFVMNTQEEIDQTIDDFENYVNGFEKAKHWRSE***A***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Pirin	Possible transcriptional coregulator. May contribute to the regulation of cellular processes via its interaction with BCL3. May be required for efficient terminal myeloid maturation of hematopoietic cells. May play a role in the regulation of cell migration. May promote apoptosis when overexpressed. Has quercetin 2,3-dioxygenase activity (in vitro).	probable	O00625
Pirin	Possible transcriptional coregulator. May contribute to the regulation of cellular processes via its interaction with BCL3. May be required for efficient terminal myeloid maturation of hematopoietic cells. May play a role in the regulation of cell migration. May promote apoptosis when overexpressed. Has quercetin 2,3-dioxygenase activity (in vitro).	probable	Q5M827
Pirin	Possible transcriptional coregulator. May contribute to the regulation of cellular processes via its interaction with BCL3. May play a role in the regulation of cell migration. May promote apoptosis when overexpressed. Has quercetin 2,3-dioxygenase activity (in vitro) (By similarity). May be required for efficient terminal myeloid maturation of hematopoietic cells.	probable	Q9D711

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J1L, chain A
Confidence level:very confident
Coverage over the Query: 13-298
View the alignment between query and template
View the model in PyMOL