Citrus Sinensis ID: 039969

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----

MYSISHTSSISFPAKPATTFRCFAASDIPAGPNSLRWPHSSSAADISIRVGPDSEGTAVGGSHGGVKVNAKEKKWSRNRESYLTDDSEPLPLPMTYPDSSPVPREEIDKRLRCDPEVQDCKEVVYEWTGKCRSCQGSGYVSYYNKRGKEIICKCIPCLGIGYVQKITARKDIEVMEDLDNGKPP

ccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccEEEEEEEECccccccCEEEEEcccccEEEEEEECcccCEEEEEEEcccHHHHHHHccccccc

******************TFRCFAASDIPAGPNSLRWPHS*********************************************DSEPLPLPMTY***************RCDPEVQDCKEVVYEWTGKCRSCQGSGYVSYYNKRGKEIICKCIPCLGIGYVQKITARKDIEV***L******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MYSISHTSSISFPAKPATTFRCFAASDIPAGPNSLRWPHSSSAADISIRVGPDSEGTAVGGSHGGVKVNAKEKKWSRNRESYLTDDSEPLPLPMTYPDSSPVPREEIDKRLRCDPEVQDCKEVVYEWTGKCRSCQGSGYVSYYNKRGKEIICKCIPCLGIGYVQKITARKDIEVMEDLDNGKPP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein disulfide-isomerase SCO2	Protein disulfide-isomerase involved in chloroplast development in cotyledons. Involved in the process of vesicle-derived thylakoid formation, probably at the level of the integration and folding of LHCB proteins at the initial location of integration. Acts only in germinating seeds after dormancy, during the transition from heterotrophic to autotrophic growth.	probable	Q93YN0

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LCZ, chain A
Confidence level:probable
Coverage over the Query: 128-181
View the alignment between query and template
View the model in PyMOL