Citrus Sinensis ID: 039981


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310---
MFGASNAQLSSTFYATTCPNVSSIVRGVVEQARNNDARIGARLIRVHFHDCFVNGCDGSLLLDDSAPGGIQSEKNGNPNLSTGGYEVVDDIKTALENVCPGVVSCADILAIASQILVSLDGGPTWQVQLGRRDSRTANLAGTSGIPLGNETLDRISEKFRAVGLDDPTDLVALSGAHTFGRARCVAFRNRLFNFDGAGNPDPTIDPTYLQTLRQNCPQGGNGNALVDLDPTTADGFDNNYFTNLQNNRGLLTSDQVLFSTTGAKTVAIVNRFANSQTDFFDTFGQAMIKMGNIRPLTGNNGEIRSNCRRINSN
ccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHccccccccccccHHHcccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHccccccccccHHHHHHHHHcccccccccEEEEccccccccccccccHHHcccccccccccccccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHccccccHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccccccccccccccc
*****NAQLSSTFYATTCPNVSSIVRGVVEQARNNDARIGARLIRVHFHDCFVNGCDGSLLLDDSAP******K**NPNLSTGGYEVVDDIKTALENVCPGVVSCADILAIASQILVSLDGGPTWQVQLGRRDSRTANLAGTSGIPLGNETLDRISEKFRAVGLDDPTDLVALSGAHTFGRARCVAFRNRLFNFDGAGNPDPTIDPTYLQTLRQNCPQGGNGNALVDLDPTTADGFDNNYFTNLQNNRGLLTSDQVLFSTTGAKTVAIVNRFANSQTDFFDTFGQAMIKMGNIRPLTGNNGEIRSNCRRI***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFGASNAQLSSTFYATTCPNVSSIVRGVVEQARNNDARIGARLIRVHFHDCFVNGCDGSLLLDDSAPGGIQSEKNGNPNLSTGGYEVVDDIKTALENVCPGVVSCADILAIASQILVSLDGGPTWQVQLGRRDSRTANLAGTSGIPLGNETLDRISEKFRAVGLDDPTDLVALSGAHTFGRARCVAFRNRLFNFDGAGNPDPTIDPTYLQTLRQNCPQGGNGNALVDLDPTTADGFDNNYFTNLQNNRGLLTSDQVLFSTTGAKTVAIVNRFANSQTDFFDTFGQAMIKMGNIRPLTGNNGEIRSNCRRINSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxidase 53 Closely linked to lignin formation by showing monolignol substrate specificity.probableQ42578
Lignin-forming anionic peroxidase Plays an integral role in secondary cell wall biosynthesis by the polymerization of cinnamyl alcohols into lignin and by forming rigid cross-links between cellulose, pectin, hydroxy-proline-rich glycoproteins, and lignin.probableP11965
Peroxidase 15 Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.probableQ9LEH3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.11.-.-Acting on a peroxide as acceptor.probable
1.11.1.-Peroxidases.probable
1.11.1.7Peroxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PA2, chain A
Confidence level:very confident
Coverage over the Query: 8-313
View the alignment between query and template
View the model in PyMOL