Citrus Sinensis ID: 039982


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250---
MGRGKIEIKKIENLNSRQVTFSKRRNGLLKKAKELSVLCDADVGVIVFSSTGKLYEFSSSSMEHILSRYSKGIDLECQTNRNEEHGVPELPPKSAELNALKDEYARLRLAYMRMNGQELDGLSFKELQQLEHQLSEGMLSVKDMKEQVLLEQIRRSRLMEQKAMLENETLRKQMEELRRSSSRSPLVEFDPLERRFSFTKLKADHCGCTSNENEDDHSDTSLHLGLSSEVRRKRKAPKIESTGNDSGSQVASD
cccccccccccccccccccccccccccccHHHHHHHHHHcccccEEEEcccccccccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccc
MGRGKIEIKKIENLNSRQVTFSKRRNGLLKKAKELSVLCDADVGVIVFSSTGKLYEFSSSSMEHILSRYSKGIDL********************ELNALKDEYARLRLAYMRMNGQELDGLSFKELQQLEHQLSEGMLSVKDMKEQVLLEQIRRSRLMEQKAMLENETLR***************************************************HL*****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRGKIEIKKIENLNSRQVTFSKRRNGLLKKAKELSVLCDADVGVIVFSSTGKLYEFSSSSMEHILSRYSKGIDLECQTNRNEEHGVPELPPKSAExxxxxxxxxxxxxxxxxxxxxELDGLSFKExxxxxxxxxxxxxxxxxxxxxVLLEQIRRSRLMxxxxxxxxxxxxxxxxxxxxxSSRSPLVEFDPLERRFSFTKLKADHCGCTSNENEDDHSDTSLHLGLSSEVRRKRKAPKIESTGNDSGSQVASD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Agamous-like MADS-box protein AGL18 Probable transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Prevents premature flowering. Downstream regulator of a subset of the MIKC* MADS-controlled genes required during pollen maturation.probableQ9M2K8
MADS-box transcription factor 22 Probable transcription factor. May be required for spikelet (rice flower) development.probableQ9XJ66

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EGW, chain A
Confidence level:very confident
Coverage over the Query: 2-72
View the alignment between query and template
View the model in PyMOL
Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 122-169
View the alignment between query and template
View the model in PyMOL