Citrus Sinensis ID: 039984

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
DESTWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLEDENMDMEEKFGITIMKAQPLRAVPVAI
cccccccccccccccccccccccccccccEEccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccEEEcccccEEEEEEEc
cccccccHHHcccHHHcccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEccccEEEEEccc
destwdnphtfiperflrsnvdfkgqnfelipfgagrricpgLPLAIRMLYLMLGSLInsfdwkledenmDMEEKFGITImkaqplravpvai
destwdnphtfiperflrsnvdFKGQNFelipfgagrrICPGLPLAIRMLYLMLGSLINSFDWKLEDENMDMEEKFGItimkaqplravpvai
DESTWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLEDENMDMEEKFGITIMKAQPLRAVPVAI
********HTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLEDENMDMEEKFGITIMK***********
DESTWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLEDENMDMEEKFGITIMKAQPLRAVPVAI
DESTWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLEDENMDMEEKFGITIMKAQPLRAVPVAI
**STWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLEDENMDMEEKFGITIMKAQPLRAVPVAI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DESTWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLEDENMDMEEKFGITIMKAQPLRAVPVAI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
Q8VWZ7493 Geraniol 8-hydroxylase OS N/A no 1.0 0.188 0.639 2e-31
D1MI46495 Geraniol 8-hydroxylase OS N/A no 0.956 0.179 0.655 3e-31
O64636512 Cytochrome P450 76C1 OS=A yes no 0.978 0.177 0.578 1e-27
O64637512 Cytochrome P450 76C2 OS=A no no 0.978 0.177 0.557 2e-26
O64635511 Cytochrome P450 76C4 OS=A no no 0.978 0.178 0.547 3e-26
O23976490 7-ethoxycoumarin O-deethy N/A no 0.978 0.185 0.557 7e-26
O64638515 Cytochrome P450 76C3 OS=A no no 0.978 0.176 0.536 1e-25
P37121467 Cytochrome P450 76A1 (Fra N/A no 0.967 0.192 0.563 1e-25
Q9FXW4488 Probable (S)-N-methylcocl N/A no 0.956 0.182 0.526 1e-22
P47195487 Berbamunine synthase OS=B N/A no 0.967 0.184 0.489 1e-22
>sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 Back     alignment and function desciption
 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 62/97 (63%), Positives = 78/97 (80%), Gaps = 4/97 (4%)

Query: 1   DESTWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINS 60
           DE+ WD+   F PERF+ S +D +G++FELIPFGAGRRICPGLPLA+R + LMLGSL+NS
Sbjct: 397 DETVWDDALAFKPERFMESELDIRGRDFELIPFGAGRRICPGLPLALRTVPLMLGSLLNS 456

Query: 61  FDWKLED----ENMDMEEKFGITIMKAQPLRAVPVAI 93
           F+WKLE     +++DMEEKFGIT+ KA PLRAVP  +
Sbjct: 457 FNWKLEGGMAPKDLDMEEKFGITLQKAHPLRAVPSTL 493
Hydroxylase involved in the biosynthesis of hydroxygeraniol, a precursor of the terpenoid indole alkaloids such as vinblastine and vincristine. Also able to hydroxylate in vitro nerol and to catalyze 3'-hydroxylation of the flavanone naringenin to form eriodictyol. No activity with apigenin, kaempferol, p-coumaric acid and ferulic acid as substrates.
Catharanthus roseus (taxid: 4058)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 1EC: 5EC: 2
>sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 Back     alignment and function description
>sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 Back     alignment and function description
>sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 Back     alignment and function description
>sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 Back     alignment and function description
>sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 Back     alignment and function description
>sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 Back     alignment and function description
>sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 Back     alignment and function description
>sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
7406712 499 putative ripening-related P-450 enzyme [ 1.0 0.186 0.690 2e-34
297742641 373 unnamed protein product [Vitis vinifera] 1.0 0.249 0.690 2e-34
225426693 499 PREDICTED: cytochrome P450 76C4 [Vitis v 1.0 0.186 0.690 2e-34
359474049 399 PREDICTED: cytochrome P450 76C4-like [Vi 1.0 0.233 0.690 5e-34
359474275 499 PREDICTED: 7-ethoxycoumarin O-deethylase 1.0 0.186 0.670 3e-33
147866210 479 hypothetical protein VITISV_011260 [Viti 1.0 0.194 0.670 3e-33
224058639 493 cytochrome P450 [Populus trichocarpa] gi 1.0 0.188 0.680 4e-33
359474277 499 PREDICTED: LOW QUALITY PROTEIN: 7-ethoxy 1.0 0.186 0.670 1e-32
356535567 497 PREDICTED: 7-ethoxycoumarin O-deethylase 1.0 0.187 0.711 8e-32
225453803 465 PREDICTED: cytochrome P450 76C4-like [Vi 1.0 0.2 0.659 8e-32
>gi|7406712|emb|CAB85635.1| putative ripening-related P-450 enzyme [Vitis vinifera] Back     alignment and taxonomy information
 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 86/97 (88%), Gaps = 4/97 (4%)

Query: 1   DESTWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINS 60
           D +TW+NP++F+PERFL  ++D KGQNFELIPFGAGRRICPGLPLAIRM++LML SLI+S
Sbjct: 403 DPNTWENPNSFVPERFLGLDMDVKGQNFELIPFGAGRRICPGLPLAIRMVHLMLASLIHS 462

Query: 61  FDWKLED----ENMDMEEKFGITIMKAQPLRAVPVAI 93
           +DWKLED    ENM+MEE++GI++ KAQPL+A+PV +
Sbjct: 463 YDWKLEDGVTPENMNMEERYGISLQKAQPLQALPVRV 499

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297742641|emb|CBI34790.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225426693|ref|XP_002281735.1| PREDICTED: cytochrome P450 76C4 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359474049|ref|XP_002275279.2| PREDICTED: cytochrome P450 76C4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359474275|ref|XP_003631427.1| PREDICTED: 7-ethoxycoumarin O-deethylase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147866210|emb|CAN79423.1| hypothetical protein VITISV_011260 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224058639|ref|XP_002299579.1| cytochrome P450 [Populus trichocarpa] gi|222846837|gb|EEE84384.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359474277|ref|XP_003631428.1| PREDICTED: LOW QUALITY PROTEIN: 7-ethoxycoumarin O-deethylase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356535567|ref|XP_003536316.1| PREDICTED: 7-ethoxycoumarin O-deethylase-like [Glycine max] Back     alignment and taxonomy information
>gi|225453803|ref|XP_002276121.1| PREDICTED: cytochrome P450 76C4-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
UNIPROTKB|Q8VWZ7493 CYP76B6 "Geraniol 8-hydroxylas 0.967 0.182 0.659 1.1e-29
UNIPROTKB|D1MI46495 CYP76B10 "Geraniol 8-hydroxyla 0.956 0.179 0.655 1.9e-29
TAIR|locus:2043699512 CYP76C1 ""cytochrome P450, fam 0.978 0.177 0.578 1e-25
TAIR|locus:2043605512 CYP76C2 ""cytochrome P450, fam 0.978 0.177 0.557 8.1e-25
TAIR|locus:2100982498 CYP76C7 ""cytochrome P450, fam 0.978 0.182 0.557 9.2e-25
TAIR|locus:2012693511 CYP76C6 ""cytochrome P450, fam 0.978 0.178 0.557 1.7e-24
TAIR|locus:2043694511 CYP76C4 ""cytochrome P450, fam 0.978 0.178 0.547 2.2e-24
TAIR|locus:2012673368 CYP76C5 ""cytochrome P450, fam 0.946 0.239 0.554 3.3e-24
TAIR|locus:2043614515 CYP76C3 ""cytochrome P450, fam 0.978 0.176 0.536 1.8e-23
TAIR|locus:2031900502 CYP71B2 ""cytochrome P450, fam 0.978 0.181 0.515 1.5e-21
UNIPROTKB|Q8VWZ7 CYP76B6 "Geraniol 8-hydroxylase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
 Score = 330 (121.2 bits), Expect = 1.1e-29, P = 1.1e-29
 Identities = 62/94 (65%), Positives = 77/94 (81%)

Query:     1 DESTWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINS 60
             DE+ WD+   F PERF+ S +D +G++FELIPFGAGRRICPGLPLA+R + LMLGSL+NS
Sbjct:   397 DETVWDDALAFKPERFMESELDIRGRDFELIPFGAGRRICPGLPLALRTVPLMLGSLLNS 456

Query:    61 FDWKLED----ENMDMEEKFGITIMKAQPLRAVP 90
             F+WKLE     +++DMEEKFGIT+ KA PLRAVP
Sbjct:   457 FNWKLEGGMAPKDLDMEEKFGITLQKAHPLRAVP 490
GO:0016099 "monoterpenoid biosynthetic process" evidence=IDA
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IDA
UNIPROTKB|D1MI46 CYP76B10 "Geraniol 8-hydroxylase" [Swertia mussotii (taxid:137888)] Back     alignment and assigned GO terms
TAIR|locus:2043699 CYP76C1 ""cytochrome P450, family 76, subfamily C, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043605 CYP76C2 ""cytochrome P450, family 76, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100982 CYP76C7 ""cytochrome P450, family 76, subfamily C, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012693 CYP76C6 ""cytochrome P450, family 76, subfamily C, polypeptide 6"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043694 CYP76C4 ""cytochrome P450, family 76, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012673 CYP76C5 ""cytochrome P450, family 76, subfamily C, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043614 CYP76C3 ""cytochrome P450, family 76, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031900 CYP71B2 ""cytochrome P450, family 71, subfamily B, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 5e-30
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 3e-27
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 5e-25
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 9e-21
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 1e-20
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 4e-20
pfam00067461 pfam00067, p450, Cytochrome P450 4e-19
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-18
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 1e-15
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 2e-15
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 2e-10
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 7e-09
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 1e-08
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 2e-06
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 3e-06
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 2e-05
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 5e-05
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 5e-05
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 1e-04
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 3e-04
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 3e-04
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 0.003
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information 
 Score =  110 bits (276), Expect = 5e-30
 Identities = 45/99 (45%), Positives = 64/99 (64%), Gaps = 8/99 (8%)

Query: 1   DESTWDNPHTFIPERFL----RSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGS 56
           D   W +P  F P+RFL     + VD KG +FELIPFGAGRRIC GL   +RM+ L+  +
Sbjct: 408 DPEQWPDPLEFRPDRFLPGGEHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLLTAT 467

Query: 57  LINSFDWKLED----ENMDMEEKFGITIMKAQPLRAVPV 91
           L+++FDW+L D    + ++MEE +G+T+ +A PL   P 
Sbjct: 468 LVHAFDWELADGQTPDKLNMEEAYGLTLQRAVPLMVHPR 506

Length = 517
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.94
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.93
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.92
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.92
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.91
PLN03234499 cytochrome P450 83B1; Provisional 99.91
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.91
PLN02394503 trans-cinnamate 4-monooxygenase 99.91
PLN02183516 ferulate 5-hydroxylase 99.91
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.91
PLN02738633 carotene beta-ring hydroxylase 99.91
PLN00168519 Cytochrome P450; Provisional 99.91
PLN02971543 tryptophan N-hydroxylase 99.91
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.91
PTZ00404482 cytochrome P450; Provisional 99.91
PLN02966502 cytochrome P450 83A1 99.91
PLN02655466 ent-kaurene oxidase 99.9
PLN02687517 flavonoid 3'-monooxygenase 99.9
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.9
PLN02500490 cytochrome P450 90B1 99.9
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.9
PLN02290516 cytokinin trans-hydroxylase 99.89
PLN02774463 brassinosteroid-6-oxidase 99.89
PLN03018534 homomethionine N-hydroxylase 99.89
PLN02936489 epsilon-ring hydroxylase 99.89
PLN02302490 ent-kaurenoic acid oxidase 99.89
PLN03112514 cytochrome P450 family protein; Provisional 99.89
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.88
PLN02987472 Cytochrome P450, family 90, subfamily A 99.88
PLN02196463 abscisic acid 8'-hydroxylase 99.87
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.78
PLN02648480 allene oxide synthase 99.73
PF0849259 SRP72: SRP72 RNA-binding domain; InterPro: IPR0136 83.01
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.94  E-value=1.8e-26  Score=155.22  Aligned_cols=91  Identities=25%  Similarity=0.418  Sum_probs=76.4

Q ss_pred             CCCCCCCCCCcCCCccCCCCCCCCCCCcceeeccCCCCCCCCHHHHHHHHHHHHHHHHHhceeecCCCCCCcccc---ee
Q 039984            1 DESTWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLEDENMDMEEK---FG   77 (93)
Q Consensus         1 dp~~~~~p~~F~PeR~l~~~~~~~~~~~~~~~Fg~G~~~C~G~~~a~~~~~~~~~~ll~~f~~~~~~~~~~~~~~---~~   77 (93)
                      ||++|+||++|+||||++++.. ..++.+|+|||.|+|+|+|.+||++|+|+.++.||++|+++..+..... ..   .+
T Consensus       405 Dp~~~p~Pe~F~PERF~~~~~~-~~~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~~lL~~f~~~~~~~t~~~-~~~~~~~  482 (499)
T KOG0158|consen  405 DPEYWPEPEKFKPERFEEENNK-SRHPGAYLPFGVGPRNCIGMRFALMEAKLALAHLLRNFSFEVCPTTIIP-LEGDPKG  482 (499)
T ss_pred             CcccCCCcccCCCccCCCCccc-ccCCccccCCCCCccccHHHHHHHHHHHHHHHHHHhhCEEecCCcccCc-ccCCccc
Confidence            8999999999999999977643 4566799999999999999999999999999999999999987722222 22   26


Q ss_pred             eEeccCCCeEEEEeeC
Q 039984           78 ITIMKAQPLRAVPVAI   93 (93)
Q Consensus        78 ~~~~~~~~~~~~~~~~   93 (93)
                      .++.|..++.++..+|
T Consensus       483 ~~l~pk~gi~Lkl~~r  498 (499)
T KOG0158|consen  483 FTLSPKGGIWLKLEPR  498 (499)
T ss_pred             eeeecCCceEEEEEeC
Confidence            6778888899988775

>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PF08492 SRP72: SRP72 RNA-binding domain; InterPro: IPR013699 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 6e-08
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 1e-07
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 1e-07
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 2e-07
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 2e-07
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 6e-07
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 7e-07
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 8e-07
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 8e-07
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 1e-06
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 3e-06
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 4e-06
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 2e-05
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 6e-05
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 6e-05
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 6e-05
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 6e-05
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 1e-04
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 2e-04
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-04
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 2e-04
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-04
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-04
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 2e-04
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 4e-04
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 4e-04
3vno_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len 5e-04
3vm4_A407 Cytochrome P450sp Alpha (Cyp152b1) In Complex With 5e-04
3awp_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len 5e-04
3voo_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len 5e-04
3awm_A415 Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P 5e-04
3awq_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng 5e-04
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 5e-04
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 5e-04
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 6e-04
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 6e-04
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 7e-04
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 8e-04
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 8e-04
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 8e-04
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 8e-04
3pm0_A507 Structural Characterization Of The Complex Between 9e-04
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 9e-04
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure 
Iteration: 1

 Score = 52.4 bits (124), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
Query: 1   DESTWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINS 60
           D+  + NP+ F P  FL  N +FK  ++  +PF AG+RIC G  LA   L+L L +++ +
Sbjct: 379 DDKEFPNPNIFDPGHFLDKNGNFKKSDY-FMPFSAGKRICAGEGLARMELFLFLTTILQN 437
Query: 61  FDWKLEDE 68
           F+ K  D+
Sbjct: 438 FNLKSVDD 445
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 Back     alignment and structure
>pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 Back     alignment and structure
>pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 Back     alignment and structure
>pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 Back     alignment and structure
>pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 Back     alignment and structure
>pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-33
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 7e-32
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 5e-29
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-28
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-21
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 4e-19
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 8e-19
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-18
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-18
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-18
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 6e-18
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 3e-17
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 4e-17
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 6e-17
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 6e-16
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-15
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-15
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-15
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-14
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-13
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-11
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 2e-11
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-11
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-08
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-08
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 8e-08
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 2e-07
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 5e-07
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-06
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  118 bits (299), Expect = 1e-33
 Identities = 22/103 (21%), Positives = 42/103 (40%), Gaps = 13/103 (12%)

Query: 1   DESTWDNPHTFIPERFLRSNVDFKGQ--------NFELIPFGAGRRICPGLPLAIRMLYL 52
           D      P  F  +RFL ++   K           +  +P+G    +CPG   A+  +  
Sbjct: 365 DPQIHQQPEMFQFDRFLNADRTEKKDFFKNGARVKYPSVPWGTEDNLCPGRHFAVHAIKE 424

Query: 53  MLGSLINSFDWKLEDEN----MDMEEKFGITIM-KAQPLRAVP 90
           ++ +++  FD +L D+N    +    ++G  I+  A  L    
Sbjct: 425 LVFTILTRFDVELCDKNATVPLVDPSRYGFGILQPAGDLEIRY 467
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.95
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.93
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.93
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.93
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.92
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 99.92
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.92
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.92
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.91
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.91
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.91
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.91
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.91
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.91
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.91
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.91
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.91
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.9
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.9
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.9
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.9
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.89
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.89
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.88
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.88
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.88
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.88
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.88
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.87
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.87
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.86
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.86
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.86
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.86
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.85
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.85
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.85
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.85
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.85
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.85
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.85
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.85
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.85
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.85
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.85
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.85
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.85
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.84
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.83
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.83
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.83
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.83
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.83
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.83
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.83
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.83
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.83
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.83
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.82
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.82
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.82
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.82
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.82
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.82
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.82
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.81
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.81
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.81
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.81
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.81
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.8
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.79
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.78
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.77
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.77
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.77
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.74
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=99.95  E-value=9.4e-28  Score=158.49  Aligned_cols=91  Identities=32%  Similarity=0.623  Sum_probs=69.3

Q ss_pred             CCCCCCCCCCcCCCccCCCCCCCCCCCcceeeccCCCCCCCCHHHHHHHHHHHHHHHHHhceeecCCCC-C-Ccccceee
Q 039984            1 DESTWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLEDEN-M-DMEEKFGI   78 (93)
Q Consensus         1 dp~~~~~p~~F~PeR~l~~~~~~~~~~~~~~~Fg~G~~~C~G~~~a~~~~~~~~~~ll~~f~~~~~~~~-~-~~~~~~~~   78 (93)
                      ||++|+||++|+||||++++... ..+..++|||+|+|.|+|++||.+|+++++|.|+++|+++++++. . ......++
T Consensus       383 d~~~~~dP~~F~PeRfl~~~~~~-~~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~  461 (479)
T 3tbg_A          383 DEAVWEKPFRFHPEHFLDAQGHF-VKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAF  461 (479)
T ss_dssp             CTTTSSSTTSCCGGGGBCTTCCB-CCCTTCCTTCCSTTSCTTHHHHHHHHHHHHHHHHHHEEEECCTTSCCCCSCEEESS
T ss_pred             ChhhCCCccccCccccCCCCccc-CCCCceecCCCCCcCChhHHHHHHHHHHHHHHHHHccEEEeCCCCCCcccccccee
Confidence            79999999999999999866432 345589999999999999999999999999999999999987632 2 22223344


Q ss_pred             EeccCCCeEEEEeeC
Q 039984           79 TIMKAQPLRAVPVAI   93 (93)
Q Consensus        79 ~~~~~~~~~~~~~~~   93 (93)
                      +..|. ++.++++||
T Consensus       462 ~~~P~-~~~v~~~pR  475 (479)
T 3tbg_A          462 LVSPS-PYELCAVPR  475 (479)
T ss_dssp             SEEEC-CCCBEEEEC
T ss_pred             eecCC-CeEEEEEEC
Confidence            44443 444554443
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 93
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-22
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-21
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 2e-21
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 3e-21
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 4e-21
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 7e-17
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 2e-16
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-13
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 1e-13
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 9e-13
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 2e-12
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 2e-12
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 4e-12
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 1e-11
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 3e-11
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 4e-11
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 5e-11
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 9e-11
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 6e-10
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 3e-09
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 1e-08
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 86.3 bits (212), Expect = 5e-22
 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 5/95 (5%)

Query: 1   DESTWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINS 60
           D   + NP  F P  FL    +FK  +   +PF AG+RIC G  LA   L+L L S++ +
Sbjct: 372 DNKEFPNPEMFDPHHFLDEGGNFKK-SKYFMPFSAGKRICVGEALAGMELFLFLTSILQN 430

Query: 61  FDWKL--EDENMDMEEKFG--ITIMKAQPLRAVPV 91
           F+ K   + +N+D         ++     L  +P+
Sbjct: 431 FNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPI 465
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.94
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.94
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.93
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.93
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.93
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.9
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.9
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.9
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.87
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.87
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.87
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.87
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.86
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.85
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.85
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.84
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.83
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.82
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.81
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.79
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.78
d1aisa289 TATA-box binding protein (TBP), C-terminal domain 84.28
d1mp9a192 TATA-box binding protein (TBP), C-terminal domain 82.56
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=1.1e-27  Score=155.81  Aligned_cols=92  Identities=26%  Similarity=0.516  Sum_probs=76.3

Q ss_pred             CCCCCCCCCCcCCCccCCCCCCCCCCCcceeeccCCCCCCCCHHHHHHHHHHHHHHHHHhceeecCC-CCCCcccceeeE
Q 039984            1 DESTWDNPHTFIPERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLED-ENMDMEEKFGIT   79 (93)
Q Consensus         1 dp~~~~~p~~F~PeR~l~~~~~~~~~~~~~~~Fg~G~~~C~G~~~a~~~~~~~~~~ll~~f~~~~~~-~~~~~~~~~~~~   79 (93)
                      ||++|+||++|+||||++.+.. ...+..++|||+|+|.|+|+++|.++++++++.|+++|+|++++ .+.+.......+
T Consensus       377 d~~~~~dp~~F~PeRfl~~~~~-~~~~~~~~~FG~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~  455 (472)
T d1tqna_         377 DPKYWTEPEKFLPERFSKKNKD-NIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGL  455 (472)
T ss_dssp             CTTTSSSTTSCCGGGGSTTTGG-GCCTTTSCTTCCSTTSCTTHHHHHHHHHHHHHHHHTTEEEECCTTCCSSCCBCSSSS
T ss_pred             CchhCCCccccCccccCCCCcc-cCCCceecCCCCCCccChhHHHHHHHHHHHHHHHHHhCEEEeCCCCCCCceeccceE
Confidence            7999999999999999976543 23445899999999999999999999999999999999999876 334444445556


Q ss_pred             eccCCCeEEEEeeC
Q 039984           80 IMKAQPLRAVPVAI   93 (93)
Q Consensus        80 ~~~~~~~~~~~~~~   93 (93)
                      +.|..++.+++++|
T Consensus       456 ~~p~~~~~~~~~~R  469 (472)
T d1tqna_         456 LQPEKPVVLKVESR  469 (472)
T ss_dssp             CCBSSCCEEEEEET
T ss_pred             EeeCCCEEEEEEEC
Confidence            67777888888876
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1aisa2 d.129.1.1 (A:93-181) TATA-box binding protein (TBP), C-terminal domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1mp9a1 d.129.1.1 (A:5-96) TATA-box binding protein (TBP), C-terminal domain {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure