Citrus Sinensis ID: 040022

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490
MDALACSASNLSPLLGGATNATAAAEYICGRFEAVSNKFVDTGYAIDNTYLLFSAYLVFVMQLGFAMLCAGSVRAKNTMNIMLTNVLDAATGGLFYYLFGFAFAFGNPSNGFIGKHFFGLEAFPSPSFDYGYFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGLVYPIVSHWFWSSDGWASPTRTDNNLLFGSGVIDFAGSGVVHMVGGIAGLWGALIEGPRIGKFDHNDRPATMRGHSGTLVVLGTFLLWFGWYGFNPGSFVYILKTYGESGSYYGQWSAIGRTAITTTLAGCSAALTTLFGKRLIAGHWNVTDVCNGLLGGFAAITGGCSVVDPWAAIICGFVAAWILIGCNKLAEKFKYDDPLEAAQLHGGCGAWGVIFTGLFAKESYVNEVYPGKPGRPYGLFMGGGGKLLAAHIVQILVITGWVSVTMGTLFWLLNKLKLLRISTDEEMAGMDLTSHGGLAYAYHDDLDSTQKGGFMMA
cccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccEEEcccccccccccccccccccccEEccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccccccccccccccccccccccccccccc
****A**ASNLSPLLGGATNATAAAEYICGRFEAVSNKFVDTGYAIDNTYLLFSAYLVFVMQLGFAMLCAGSVRAKNTMNIMLTNVLDAATGGLFYYLFGFAFAFGNPSNGFIGKHFFGLEAFPSPSFDYGYFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGLVYPIVSHWFWSSDGWASPTRTDNNLLFGSGVIDFAGSGVVHMVGGIAGLWGALIEGPRIGKFDHNDRPATMRGHSGTLVVLGTFLLWFGWYGFNPGSFVYILKTYGESGSYYGQWSAIGRTAITTTLAGCSAALTTLFGKRLIAGHWNVTDVCNGLLGGFAAITGGCSVVDPWAAIICGFVAAWILIGCNKLAEKFKYDDPLEAAQLHGGCGAWGVIFTGLFAKESYVNEVYPGKPGRPYGLFMGGGGKLLAAHIVQILVITGWVSVTMGTLFWLLNKLKLLRISTDEEMAGMDLTSHGGLAYAYHDDL***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDALACSASNLSPLLGGATNATAAAEYICGRFEAVSNKFVDTGYAIDNTYLLFSAYLVFVMQLGFAMLCAGSVRAKNTMNIMLTNVLDAATGGLFYYLFGFAFAFGNPSNGFIGKHFFGLEAFPSPSFDYGYFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGLVYPIVSHWFWSSDGWASPTRTDNNLLFGSGVIDFAGSGVVHMVGGIAGLWGALIEGPRIGKFDHNDRPATMRGHSGTLVVLGTFLLWFGWYGFNPGSFVYILKTYGESGSYYGQWSAIGRTAITTTLAGCSAALTTLFGKRLIAGHWNVTDVCNGLLGGFAAITGGCSVVDPWAAIICGFVAAWILIGCNKLAEKFKYDDPLEAAQLHGGCGAWGVIFTGLFAKESYVNEVYPGKPGRPYGLFMGGGGKLLAAHIVQILVITGWVSVTMGTLFWLLNKLKLLRISTDEEMAGMDLTSHGGLAYAYHDDLDSTQKGGFMMA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ammonium transporter 1 member 1 High affinity ammonium transporter probably involved in ammonium uptake from the soil, long-distance transport to the shoots and re-uptake of apoplastic ammonium that derives from photorespiration in shoots. Contributes with AMT1-3 to the overall ammonium uptake capacity in roots under nitrogen-deficiency conditions.confidentP54144
Ammonium transporter 1 member 2 Ammonium transporter probably involved in ammonium uptake from the soil and ammonium uptake and retrieval in the vascular system.confidentQ6K9G1
Ammonium transporter 1 member 2 Ammonium transporter probably involved in ammonium uptake from the soil.probableO04161

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B2H, chain A
Confidence level:very confident
Coverage over the Query: 44-187,198-272,286-474
View the alignment between query and template
View the model in PyMOL
Template: 3C1J, chain A
Confidence level:confident
Coverage over the Query: 47-181,193-225,238-267,282-455
View the alignment between query and template
View the model in PyMOL