Citrus Sinensis ID: 040046

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
MARGKIQIKRIENATNRQVTFSKRRNGLFKKAQELTVLCDAKVSIIMCSSTGKVQEYVSSSTTTKQLLDEYQRRLKIDLWSSQYEKMQENLKNLKEVNINLKKEIRQRLGESLNDLSLKKLSDLEQDVDNCLRIIRERKLRAISGQIVTHRKKVRREEEENRKLRNGFIINAKEEDQHYELVDNEGHYDSVIRFQNGGPGIFALRLQPNEPLSSQWMSIHE
ccccccHHHHcccccccccccccccccccccHHHHHHcccccEEEEEEcccccEEccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccc
MARGKIQIKRIENATNRQVTFSKRRNGLFKKAQELTVLCDAKVSIIMCSSTGKVQEYVSSSTTTKQLLDEYQRRLKIDLWSSQYEKMQENLKNLKEVNINLKKEIRQRLGESLNDLSLKKLSDLEQDVDNCLRIIRERKLRAISGQIVTHRKKVRREEEENRKLRNGFIINAKEEDQHYELVDNEGHYDSVIRFQNGGPGIFALRLQ**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARGKIQIKRIENATNRQVTFSKRRNGLFKKAQELTVLCDAKVSIIMCSSTGKVQEYVSSSTTTKQLLDEYQRRLKxxxxxxxxxxxxxxxxxxxxxxxxxxxxIRQRLGESLNDLSLKKLSDLEQDVDNCLRIIRERKLRAISGQxxxxxxxxxxxxxxxxxxxxxFIINAKEEDQHYELVDNEGHYDSVIRFQNGGPGIFALRLQPNEPLSSQWMSIHE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Floral homeotic protein APETALA 3 Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms an heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP.probableP35632
MADS-box transcription factor 16 Probable transcription factor involved in the development of floral organs. Required for normal development of lodicules and stamens (whorls 2 and 3). May function as an heterodimer with MADS4.probableQ944S9
Floral homeotic protein DEFICIENS Transcription factor involved in the genetic control of flower development. Acts in conjunction with GLOBOSA (glo).probableP23706

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MNM, chain A
Confidence level:very confident
Coverage over the Query: 1-83
View the alignment between query and template
View the model in PyMOL