Citrus Sinensis ID: 040066
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| 356573095 | 346 | PREDICTED: LOW QUALITY PROTEIN: auxin-in | 0.980 | 0.572 | 0.803 | 2e-94 | |
| 255542308 | 346 | aldo/keto reductase, putative [Ricinus c | 0.995 | 0.580 | 0.803 | 2e-92 | |
| 356571605 | 345 | PREDICTED: LOW QUALITY PROTEIN: auxin-in | 0.975 | 0.571 | 0.782 | 9e-92 | |
| 225451316 | 347 | PREDICTED: auxin-induced protein PCNT115 | 0.995 | 0.579 | 0.8 | 2e-91 | |
| 255542306 | 350 | aldo/keto reductase, putative [Ricinus c | 0.995 | 0.574 | 0.784 | 3e-91 | |
| 359487903 | 335 | PREDICTED: auxin-induced protein PCNT115 | 0.995 | 0.6 | 0.795 | 5e-91 | |
| 224125632 | 348 | predicted protein [Populus trichocarpa] | 0.995 | 0.577 | 0.764 | 1e-90 | |
| 225451312 | 342 | PREDICTED: auxin-induced protein PCNT115 | 0.965 | 0.570 | 0.802 | 2e-89 | |
| 356505965 | 351 | PREDICTED: auxin-induced protein PCNT115 | 1.0 | 0.575 | 0.752 | 3e-89 | |
| 356505967 | 359 | PREDICTED: auxin-induced protein PCNT115 | 1.0 | 0.562 | 0.752 | 5e-89 |
| >gi|356573095|ref|XP_003554700.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein PCNT115-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 350 bits (897), Expect = 2e-94, Method: Compositional matrix adjust.
Identities = 159/198 (80%), Positives = 183/198 (92%)
Query: 5 QRIEIPRVKLGGQGFEVSKLGFGCMGLTGIYNDPVPVEVGISIIKHAFDQGITFFDTADV 64
Q +EIPRVKLG QG EVSKLG+GCMGLTG YNDP+P E GISIIKHAF +GITFFDT+D+
Sbjct: 3 QSVEIPRVKLGTQGLEVSKLGYGCMGLTGAYNDPLPEEEGISIIKHAFSKGITFFDTSDI 62
Query: 65 YGPNNANELLVGKALKQLPREKVQLATKFGIVKFDMSDVVVKGTPEYVRACCEASLKRLD 124
YGP++ANE++VGKALKQLPREK+Q+ATKFGI K D S + VKGTPEY R+CCEASLKRL
Sbjct: 63 YGPDHANEIVVGKALKQLPREKIQIATKFGITKIDSSGMFVKGTPEYARSCCEASLKRLG 122
Query: 125 VEYIDLYYQHRVDTTIPIEDTMGELKKLVEEGKIKYIGLSEASPDTIRRAHAVHPVTALQ 184
VEYIDLYYQHRVD ++PIE+T+GELKKLVEEGK++YIGLSEASPDTIRRAHAVHP+TA+Q
Sbjct: 123 VEYIDLYYQHRVDLSVPIEETIGELKKLVEEGKVRYIGLSEASPDTIRRAHAVHPITAVQ 182
Query: 185 MEWSLWTREIEDEIVPLC 202
MEWSLWTR+IEDEI+PLC
Sbjct: 183 MEWSLWTRDIEDEIIPLC 200
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255542308|ref|XP_002512217.1| aldo/keto reductase, putative [Ricinus communis] gi|223548178|gb|EEF49669.1| aldo/keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356571605|ref|XP_003553967.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein PCNT115-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225451316|ref|XP_002278850.1| PREDICTED: auxin-induced protein PCNT115 isoform 1 [Vitis vinifera] gi|298204869|emb|CBI34176.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255542306|ref|XP_002512216.1| aldo/keto reductase, putative [Ricinus communis] gi|223548177|gb|EEF49668.1| aldo/keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359487903|ref|XP_003633671.1| PREDICTED: auxin-induced protein PCNT115 isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224125632|ref|XP_002319637.1| predicted protein [Populus trichocarpa] gi|222858013|gb|EEE95560.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225451312|ref|XP_002278643.1| PREDICTED: auxin-induced protein PCNT115 [Vitis vinifera] gi|298204874|emb|CBI34181.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356505965|ref|XP_003521759.1| PREDICTED: auxin-induced protein PCNT115-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356505967|ref|XP_003521760.1| PREDICTED: auxin-induced protein PCNT115-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| TAIR|locus:2036611 | 345 | AT1G60690 "AT1G60690" [Arabido | 0.980 | 0.573 | 0.653 | 3.6e-66 | |
| TAIR|locus:2036504 | 345 | ATB2 [Arabidopsis thaliana (ta | 0.950 | 0.556 | 0.659 | 2e-65 | |
| TAIR|locus:2036551 | 330 | AT1G60750 [Arabidopsis thalian | 0.990 | 0.606 | 0.623 | 2.5e-65 | |
| TAIR|locus:2036591 | 346 | AT1G60680 "AT1G60680" [Arabido | 0.975 | 0.569 | 0.637 | 1.1e-64 | |
| TAIR|locus:2196446 | 344 | AT1G10810 "AT1G10810" [Arabido | 0.945 | 0.555 | 0.625 | 3.4e-61 | |
| TIGR_CMR|SPO_A0345 | 327 | SPO_A0345 "oxidoreductase, ald | 0.930 | 0.574 | 0.518 | 7.1e-45 | |
| TIGR_CMR|GSU_3126 | 334 | GSU_3126 "oxidoreductase, aldo | 0.910 | 0.550 | 0.505 | 1.7e-43 | |
| POMBASE|SPAC1F7.12 | 340 | yak3 "aldose reductase ARK13 f | 0.915 | 0.544 | 0.471 | 8.9e-38 | |
| UNIPROTKB|G4NAH9 | 341 | MGG_09715 "Aldo-keto reductase | 0.920 | 0.545 | 0.419 | 1.2e-35 | |
| ASPGD|ASPL0000051701 | 339 | AN10217 [Emericella nidulans ( | 0.935 | 0.557 | 0.430 | 4.6e-34 |
| TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 673 (242.0 bits), Expect = 3.6e-66, P = 3.6e-66
Identities = 132/202 (65%), Positives = 154/202 (76%)
Query: 1 MAEEQRIEIPRVKLGGQGFEVSKLGFGCMGLTGIYNDPVPVEVGISIIKHAFDQGITFFD 60
MAE R+ R+KLG QG EVS G GCMGLTG Y P I++I HA G+TF D
Sbjct: 1 MAESCRVR--RIKLGSQGLEVSAQGLGCMGLTGHYGASKPETEAIALIHHAIHSGVTFLD 58
Query: 61 TADVYGPNNANELLVGKALKQLPREKVQLATKFGIVKFDMSDVVVKGTPEYVRACCEASL 120
T+D+YGP NE+L+GKALK REKV+LATKFGI + + +KG P YVRA CEASL
Sbjct: 59 TSDMYGPET-NEILLGKALKDGVREKVELATKFGI-SYAEGNREIKGDPAYVRAACEASL 116
Query: 121 KRLDVEYIDLYYQHRVDTTIPIEDTMGELKKLVEEGKIKYIGLSEASPDTIRRAHAVHPV 180
KRLDV IDLYYQHR+DT +PIE TMGELKKL+EEGKIKYIGLSEAS TIRRAH VHP+
Sbjct: 117 KRLDVTCIDLYYQHRIDTRVPIEITMGELKKLIEEGKIKYIGLSEASASTIRRAHTVHPI 176
Query: 181 TALQMEWSLWTREIEDEIVPLC 202
TA+Q+EWSLWTR++E+EIVP C
Sbjct: 177 TAVQLEWSLWTRDVEEEIVPTC 198
|
|
| TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_A0345 SPO_A0345 "oxidoreductase, aldo/keto reductase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NAH9 MGG_09715 "Aldo-keto reductase yakc" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000051701 AN10217 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| COG0667 | 316 | COG0667, Tas, Predicted oxidoreductases (related t | 6e-73 | |
| cd06660 | 285 | cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) | 8e-73 | |
| pfam00248 | 277 | pfam00248, Aldo_ket_red, Aldo/keto reductase famil | 5e-55 | |
| COG0656 | 280 | COG0656, ARA1, Aldo/keto reductases, related to di | 6e-31 | |
| COG4989 | 298 | COG4989, COG4989, Predicted oxidoreductase [Genera | 1e-24 | |
| PLN02587 | 314 | PLN02587, PLN02587, L-galactose dehydrogenase | 2e-23 | |
| COG1453 | 391 | COG1453, COG1453, Predicted oxidoreductases of the | 3e-22 | |
| PRK09912 | 346 | PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r | 5e-21 | |
| TIGR01293 | 317 | TIGR01293, Kv_beta, voltage-dependent potassium ch | 3e-13 | |
| PRK10376 | 290 | PRK10376, PRK10376, putative oxidoreductase; Provi | 3e-11 | |
| PRK10625 | 346 | PRK10625, tas, putative aldo-keto reductase; Provi | 3e-11 | |
| PRK11565 | 275 | PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A | 3e-09 | |
| PRK11172 | 267 | PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B | 7e-07 |
| >gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
Score = 222 bits (569), Expect = 6e-73
Identities = 89/200 (44%), Positives = 120/200 (60%), Gaps = 11/200 (5%)
Query: 9 IPRVKLGGQGFEVSKLGFGCMGLTGIYNDPVPVEVGISIIKHAFDQGITFFDTADVYGPN 68
+ +LG G +VS LG G M L G +D E I I+ A D GI FFDTADVYG
Sbjct: 1 MKYRRLGRSGLKVSPLGLGTMTLGGDTDDEEEAE-AIEILDAALDAGINFFDTADVYGDG 59
Query: 69 NANELLVGKALKQLP-REKVQLATKFGIVKFDMSD----VVVKGTPEYVRACCEASLKRL 123
+E ++G+ALK+ R+KV +ATK G + D V + +++R EASLKRL
Sbjct: 60 R-SEEILGEALKERGRRDKVVIATKVG---YRPGDPGPNGVFGLSRDHIRRAVEASLKRL 115
Query: 124 DVEYIDLYYQHRVDTTIPIEDTMGELKKLVEEGKIKYIGLSEASPDTIRRAHAV-HPVTA 182
+YIDLY HR D PIE+T+ L +LV EGKI+YIG+S S + I A AV P+ +
Sbjct: 116 GTDYIDLYQLHRPDPETPIEETLEALDELVREGKIRYIGVSNYSAEQIAEALAVAAPIDS 175
Query: 183 LQMEWSLWTREIEDEIVPLC 202
LQ E++L R+ E E++PLC
Sbjct: 176 LQPEYNLLERDAEKELLPLC 195
|
Length = 316 |
| >gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| COG0667 | 316 | Tas Predicted oxidoreductases (related to aryl-alc | 100.0 | |
| KOG1575 | 336 | consensus Voltage-gated shaker-like K+ channel, su | 100.0 | |
| COG0656 | 280 | ARA1 Aldo/keto reductases, related to diketogulona | 100.0 | |
| PRK09912 | 346 | L-glyceraldehyde 3-phosphate reductase; Provisiona | 100.0 | |
| TIGR01293 | 317 | Kv_beta voltage-dependent potassium channel beta s | 100.0 | |
| cd06660 | 285 | Aldo_ket_red Aldo-keto reductases (AKRs) are a sup | 100.0 | |
| PRK10625 | 346 | tas putative aldo-keto reductase; Provisional | 100.0 | |
| KOG1577 | 300 | consensus Aldo/keto reductase family proteins [Gen | 100.0 | |
| PRK10376 | 290 | putative oxidoreductase; Provisional | 100.0 | |
| PLN02587 | 314 | L-galactose dehydrogenase | 100.0 | |
| PF00248 | 283 | Aldo_ket_red: Aldo/keto reductase family; InterPro | 100.0 | |
| PRK14863 | 292 | bifunctional regulator KidO; Provisional | 100.0 | |
| PRK11565 | 275 | dkgA 2,5-diketo-D-gluconate reductase A; Provision | 100.0 | |
| PRK11172 | 267 | dkgB 2,5-diketo-D-gluconate reductase B; Provision | 100.0 | |
| COG4989 | 298 | Predicted oxidoreductase [General function predict | 100.0 | |
| KOG1576 | 342 | consensus Predicted oxidoreductase [Energy product | 100.0 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 100.0 | |
| KOG3023 | 285 | consensus Glutamate-cysteine ligase regulatory sub | 97.16 | |
| COG0635 | 416 | HemN Coproporphyrinogen III oxidase and related Fe | 90.11 | |
| PRK13958 | 207 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 89.23 | |
| PRK07379 | 400 | coproporphyrinogen III oxidase; Provisional | 86.78 | |
| PRK01222 | 210 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 85.3 | |
| PRK06294 | 370 | coproporphyrinogen III oxidase; Provisional | 85.02 | |
| PRK08446 | 350 | coproporphyrinogen III oxidase; Provisional | 83.68 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 82.83 | |
| PRK09058 | 449 | coproporphyrinogen III oxidase; Provisional | 82.2 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 82.16 | |
| PRK10550 | 312 | tRNA-dihydrouridine synthase C; Provisional | 80.38 |
| >COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-49 Score=329.84 Aligned_cols=192 Identities=46% Similarity=0.701 Sum_probs=172.5
Q ss_pred ccceecCCCCccccceeeecccCCCCCCCCCCHHHHHHHHHHHHHcCCCeeeCcCCcCCCChhHHHHHHHHhcCC-CCCE
Q 040066 9 IPRVKLGGQGFEVSKLGFGCMGLTGIYNDPVPVEVGISIIKHAFDQGITFFDTADVYGPNNANELLVGKALKQLP-REKV 87 (202)
Q Consensus 9 ~~~~~lg~~g~~vs~lg~Gt~~~~~~~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~~g~~e~~lg~~l~~~~-r~~~ 87 (202)
|++++||++|+.||+||||||.+|+. +...+++++.++|++|+++|||+||||+.||. |.||+++|+||++.+ |+++
T Consensus 1 m~~r~lG~~gl~vs~lglG~~~~g~~-~~~~~~~~a~~il~~A~d~Gin~~DTA~~Yg~-g~sE~ilG~~l~~~~~Rd~v 78 (316)
T COG0667 1 MKYRRLGRSGLKVSPLGLGTMTLGGD-TDDEEEAEAIEILDAALDAGINFFDTADVYGD-GRSEEILGEALKERGRRDKV 78 (316)
T ss_pred CCceecCCCCceecceeeeccccCCC-CCchhhhHHHHHHHHHHHcCCCEEECccccCC-CchHHHHHHHHhccCCCCeE
Confidence 67899999999999999999999864 33345668888999999999999999999998 799999999999876 8999
Q ss_pred EEEeccCcccCCCCCc-ccCCCHHHHHHHHHHHHhHcCCCcccEEEeecCCCCCCHHHHHHHHHHHHHcCCccEEEecCC
Q 040066 88 QLATKFGIVKFDMSDV-VVKGTPEYVRACCEASLKRLDVEYIDLYYQHRVDTTIPIEDTMGELKKLVEEGKIKYIGLSEA 166 (202)
Q Consensus 88 ~i~tK~~~~~~~~~~~-~~~~~~~~i~~~~~~sL~~Lg~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~vr~iGvsn~ 166 (202)
+|+||++......... ....++++|+++++.||+|||+||||+||+||||...+.++++++|.+|+++|+||+||+||+
T Consensus 79 vIaTK~g~~~~~~~~~~~~~~s~~~i~~~v~~SL~RLgtd~IDl~~iH~~d~~~p~~e~~~aL~~l~~~G~ir~iG~S~~ 158 (316)
T COG0667 79 VIATKVGYRPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDELVREGKIRYIGVSNY 158 (316)
T ss_pred EEEEeeccCCCCCCCCccCCCCHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCCCHHHHHHHHHHHHHcCCeeEEEecCC
Confidence 9999998765431111 246799999999999999999999999999999999999999999999999999999999999
Q ss_pred CHHHHHHHhcC-CCeeEEcccCCcccccccccccCCC
Q 040066 167 SPDTIRRAHAV-HPVTALQMEWSLWTREIEDEIVPLC 202 (202)
Q Consensus 167 ~~~~l~~~~~~-~~~~~~q~~~n~~~~~~~~~ll~~~ 202 (202)
+.+++.++++. .+++++|.+||+++|+.+.+++++|
T Consensus 159 ~~~~i~~a~~~~~~~~~~Q~~ynl~~R~~e~~l~~~~ 195 (316)
T COG0667 159 SAEQIAEALAVAAPIDSLQPEYNLLERDAEKELLPLC 195 (316)
T ss_pred CHHHHHHHHHhcCCceeecccCccccccchhHHHHHH
Confidence 99999999999 5999999999999998887788776
|
|
| >KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >PRK10625 tas putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10376 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02587 L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] | Back alignment and domain information |
|---|
| >PRK14863 bifunctional regulator KidO; Provisional | Back alignment and domain information |
|---|
| >PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >COG4989 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07379 coproporphyrinogen III oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK06294 coproporphyrinogen III oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08446 coproporphyrinogen III oxidase; Provisional | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09058 coproporphyrinogen III oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >PRK10550 tRNA-dihydrouridine synthase C; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 202 | ||||
| 3v0u_A | 338 | Crystal Structure Of Perakine Reductase, Founder Me | 1e-87 | ||
| 3v0t_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 1e-87 | ||
| 3uyi_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 4e-87 | ||
| 3v0s_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 2e-84 | ||
| 1pyf_A | 312 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 7e-23 | ||
| 1pz1_A | 333 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 1e-22 | ||
| 3erp_A | 353 | Structure Of Idp01002, A Putative Oxidoreductase Fr | 2e-21 | ||
| 3n2t_A | 348 | Structure Of The Glycerol Dehydrogenase Akr11b4 Fro | 3e-21 | ||
| 1ynp_A | 317 | Aldo-keto Reductase Akr11c1 From Bacillus Haloduran | 2e-19 | ||
| 3n6q_A | 346 | Crystal Structure Of Yghz From E. Coli Length = 346 | 1e-18 | ||
| 4aub_A | 366 | The Complex Structure Of The Bacterial Aldo-Keto Re | 1e-18 | ||
| 3eb3_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (W121a) I | 1e-13 | ||
| 1zsx_A | 347 | Crystal Structure Of Human Potassium Channel Kv Bet | 2e-13 | ||
| 1qrq_A | 325 | Structure Of A Voltage-Dependent K+ Channel Beta Su | 2e-13 | ||
| 1exb_A | 332 | Structure Of The Cytoplasmic Beta Subunit-T1 Assemb | 2e-13 | ||
| 2a79_A | 333 | Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu | 2e-13 | ||
| 3eb4_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (I211r) I | 2e-13 | ||
| 3eau_A | 327 | Voltage-Dependent K+ Channel Beta Subunit In Comple | 2e-13 | ||
| 3lut_A | 367 | A Structural Model For The Full-Length Shaker Potas | 2e-13 | ||
| 1og6_A | 298 | Ydhf, An Aldo-keto Reductase From E.coli Complexed | 7e-11 | ||
| 3up8_A | 298 | Crystal Structure Of A Putative 2,5-Diketo-D-Glucon | 8e-10 | ||
| 1ur3_M | 319 | Crystal Structure Of The Apo Form Of The E.Coli Ydh | 2e-09 | ||
| 1qwk_A | 317 | Structural Genomics Of Caenorhabditis Elegans: Hypo | 1e-08 | ||
| 1gve_A | 327 | Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Live | 2e-08 | ||
| 2bp1_B | 360 | Structure Of The Aflatoxin Aldehyde Reductase In Co | 3e-08 | ||
| 2c91_A | 338 | Mouse Succinic Semialdehyde Reductase, Akr7a5 Lengt | 6e-08 | ||
| 2clp_A | 347 | Crystal Structure Of Human Aflatoxin B1 Aldehyde Re | 1e-07 | ||
| 3o0k_A | 283 | Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL | 1e-07 | ||
| 1vp5_A | 298 | Crystal Structure Of 2,5-diketo-d-gluconic Acid Red | 3e-07 | ||
| 4gac_A | 324 | High Resolution Structure Of Mouse Aldehyde Reducta | 4e-07 | ||
| 3cv7_A | 325 | Crystal Structure Of Porcine Aldehyde Reductase Ter | 9e-07 | ||
| 1cwn_A | 324 | Crystal Structure Of Porcine Aldehyde Reductase Hol | 9e-07 | ||
| 1ae4_A | 325 | Aldehyde Reductase Complexed With Cofactor And Inhi | 9e-07 | ||
| 2wzm_A | 283 | Crystal Structure Of A Mycobacterium Aldo-Keto Redu | 1e-06 | ||
| 4fzi_A | 290 | Crystal Structure Of Prostaglandin F Synthase From | 2e-06 | ||
| 1hqt_A | 326 | The Crystal Structure Of An Aldehyde Reductase Y50f | 3e-06 | ||
| 1lqa_A | 346 | Tas Protein From Escherichia Coli In Complex With N | 4e-06 | ||
| 3krb_A | 334 | Structure Of Aldose Reductase From Giardia Lamblia | 7e-06 | ||
| 1z9a_A | 321 | Crystal Structure Of The Asn-309 To Asp Mutant Of C | 2e-05 | ||
| 1ye4_A | 322 | Crystal Structure Of The Lys-274 To Arg Mutant Of C | 2e-05 | ||
| 1jez_A | 322 | The Structure Of Xylose Reductase, A Dimeric Aldo-K | 2e-05 | ||
| 1sm9_A | 322 | Crystal Structure Of An Engineered K274rn276d Doubl | 2e-05 | ||
| 2alr_A | 324 | Aldehyde Reductase Length = 324 | 2e-05 | ||
| 1r38_A | 322 | Crystal Structure Of H114a Mutant Of Candida Tenuis | 4e-05 | ||
| 2fvl_A | 324 | Crystal Structure Of Human 3-alpha Hydroxysteroid/d | 1e-04 | ||
| 4f40_A | 288 | X-Ray Crystal Structure Of Apo Prostaglandin F Synt | 2e-04 | ||
| 1mzr_A | 296 | Structure Of Dkga From E.Coli At 2.13 A Resolution | 4e-04 | ||
| 3uwe_A | 331 | Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length | 4e-04 | ||
| 3r43_A | 331 | Akr1c3 Complexed With Mefenamic Acid Length = 331 | 4e-04 | ||
| 1s1p_A | 331 | Crystal Structures Of Prostaglandin D2 11-Ketoreduc | 4e-04 | ||
| 1ry0_A | 323 | Structure Of Prostaglandin F Synthase With Prostagl | 4e-04 | ||
| 2ipg_A | 319 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 5e-04 | ||
| 1afs_A | 323 | Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr | 5e-04 | ||
| 2ipj_A | 321 | Crystal Structure Of H3alpha-Hydroxysteroid Dehydro | 5e-04 | ||
| 1lwi_A | 322 | 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO | 5e-04 | ||
| 1ihi_A | 323 | Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy | 6e-04 | ||
| 1j96_A | 323 | Human 3alpha-Hsd Type 3 In Ternary Complex With Nad | 6e-04 | ||
| 1ral_A | 308 | Three-Dimensional Structure Of Rat Liver 3alpha- Hy | 6e-04 | ||
| 1xjb_A | 325 | Crystal Structure Of Human Type 3 3alpha-Hydroxyste | 6e-04 | ||
| 1vbj_A | 281 | The Crystal Structure Of Prostaglandin F Synthase F | 7e-04 | ||
| 3cv6_A | 323 | The Crystal Structure Of Mouse 17-Alpha Hydroxyster | 7e-04 | ||
| 3fjn_A | 323 | The Crystal Structure Of 17-Alpha Hydroxysteroid De | 8e-04 | ||
| 2ipf_A | 318 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 8e-04 | ||
| 2he5_A | 323 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 8e-04 |
| >pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 | Back alignment and structure |
|
| >pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 | Back alignment and structure |
| >pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 | Back alignment and structure |
| >pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 | Back alignment and structure |
| >pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 | Back alignment and structure |
| >pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 | Back alignment and structure |
| >pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 | Back alignment and structure |
| >pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 | Back alignment and structure |
| >pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 | Back alignment and structure |
| >pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 | Back alignment and structure |
| >pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 | Back alignment and structure |
| >pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 | Back alignment and structure |
| >pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 | Back alignment and structure |
| >pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 | Back alignment and structure |
| >pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 | Back alignment and structure |
| >pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 | Back alignment and structure |
| >pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 | Back alignment and structure |
| >pdb|1GVE|A Chain A, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 | Back alignment and structure |
| >pdb|2C91|A Chain A, Mouse Succinic Semialdehyde Reductase, Akr7a5 Length = 338 | Back alignment and structure |
| >pdb|2CLP|A Chain A, Crystal Structure Of Human Aflatoxin B1 Aldehyde Reductase Member 3 Length = 347 | Back alignment and structure |
| >pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 | Back alignment and structure |
| >pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 | Back alignment and structure |
| >pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 | Back alignment and structure |
| >pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 | Back alignment and structure |
| >pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 | Back alignment and structure |
| >pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 | Back alignment and structure |
| >pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 | Back alignment and structure |
| >pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 | Back alignment and structure |
| >pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 | Back alignment and structure |
| >pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 | Back alignment and structure |
| >pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 | Back alignment and structure |
| >pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 | Back alignment and structure |
| >pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 | Back alignment and structure |
| >pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 | Back alignment and structure |
| >pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 | Back alignment and structure |
| >pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 | Back alignment and structure |
| >pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 | Back alignment and structure |
| >pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 | Back alignment and structure |
| >pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 | Back alignment and structure |
| >pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 | Back alignment and structure |
| >pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 | Back alignment and structure |
| >pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 | Back alignment and structure |
| >pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 | Back alignment and structure |
| >pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 | Back alignment and structure |
| >pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 | Back alignment and structure |
| >pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 | Back alignment and structure |
| >pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 | Back alignment and structure |
| >pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 | Back alignment and structure |
| >pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 | Back alignment and structure |
| >pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 | Back alignment and structure |
| >pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 | Back alignment and structure |
| >pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 | Back alignment and structure |
| >pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 | Back alignment and structure |
| >pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 | Back alignment and structure |
| >pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 1e-116 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 1e-115 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 1e-102 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 1e-97 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 4e-89 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 3e-85 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 3e-56 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 7e-54 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 8e-53 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 2e-52 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 5e-52 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 1e-51 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 1e-39 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 4e-20 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 6e-19 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 3e-18 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 5e-18 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 1e-17 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 2e-17 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 2e-17 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 3e-17 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 4e-17 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 4e-17 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 6e-17 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 6e-17 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 8e-17 | |
| 2ao0_A | 324 | Aldehyde dehydrogenase; TIM barrel, aldo-keto redu | 9e-17 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 1e-16 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 3e-16 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 3e-16 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 9e-16 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 1e-15 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 2e-15 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 2e-15 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 2e-15 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 2e-15 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 3e-15 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 2e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-06 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 3e-04 |
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 | Back alignment and structure |
|---|
Score = 331 bits (852), Expect = e-116
Identities = 61/193 (31%), Positives = 101/193 (52%), Gaps = 3/193 (1%)
Query: 11 RVKLGGQGFEVSKLGFGCMGLTG-IYNDPVPVEVGISIIKHAFDQGITFFDTADVYGPNN 69
+ KLG +V +G G + G + E G +++ A G+T DTA +YG
Sbjct: 3 KAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIG- 61
Query: 70 ANELLVGKALKQLPREKVQLATKFGIVKFDMSDVVVKGTPEYVRACCEASLKRLDVEYID 129
+E L+G+ L++ RE V +ATK +D V +P++++ + SLKRL+ +YID
Sbjct: 62 RSEELIGEVLREFNREDVVIATKAAHR-KQGNDFVFDNSPDFLKKSVDESLKRLNTDYID 120
Query: 130 LYYQHRVDTTIPIEDTMGELKKLVEEGKIKYIGLSEASPDTIRRAHAVHPVTALQMEWSL 189
L+Y H D P ++ + L ++ + GKI+ IG+S S + ++ A+ V LQ E++L
Sbjct: 121 LFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNL 180
Query: 190 WTREIEDEIVPLC 202
RE E P
Sbjct: 181 LNREAEKTFFPYT 193
|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 100.0 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 100.0 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 100.0 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 100.0 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 100.0 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 100.0 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 100.0 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 100.0 | |
| 4exb_A | 292 | Putative uncharacterized protein; aldo-keto reduct | 100.0 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 100.0 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 100.0 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 100.0 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 100.0 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 100.0 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 100.0 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 100.0 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 100.0 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 100.0 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 100.0 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 100.0 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 100.0 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 100.0 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 100.0 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 100.0 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 100.0 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 100.0 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 100.0 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 100.0 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 100.0 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 100.0 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 100.0 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 100.0 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 100.0 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 100.0 | |
| 3b3d_A | 314 | YTBE protein, putative morphine dehydrogenase; ald | 100.0 | |
| 4gac_A | 324 | Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe | 100.0 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 94.15 | |
| 1vyr_A | 364 | Pentaerythritol tetranitrate reductase; oxidoreduc | 83.9 | |
| 2gou_A | 365 | Oxidoreductase, FMN-binding; OLD yeallow enzyme, f | 83.86 |
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.9e-51 Score=346.03 Aligned_cols=194 Identities=75% Similarity=1.234 Sum_probs=171.4
Q ss_pred ccceecCCCCccccceeeecccCCCCCCCCCCHHHHHHHHHHHHHcCCCeeeCcCCcCCCChhHHHHHHHHhcCCCCCEE
Q 040066 9 IPRVKLGGQGFEVSKLGFGCMGLTGIYNDPVPVEVGISIIKHAFDQGITFFDTADVYGPNNANELLVGKALKQLPREKVQ 88 (202)
Q Consensus 9 ~~~~~lg~~g~~vs~lg~Gt~~~~~~~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~~g~~e~~lg~~l~~~~r~~~~ 88 (202)
|++++||++|++||+||||||++|+.|+...+++++.++|+.|++.|||+||||+.||.+|.||+.+|++|++.+|++++
T Consensus 1 M~~~~lg~tg~~vs~lglGt~~~g~~~~~~~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~~G~sE~~lG~al~~~~R~~~~ 80 (337)
T 3v0s_A 1 MPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGENGSNEELLGKALKQLPREXIQ 80 (337)
T ss_dssp CCEEECSSSSCEEESSCEECGGGC-------CHHHHHHHHHHHHHTTCCEEECCTTSSSTTHHHHHHHHHHTTSCGGGCE
T ss_pred CCeeecCCCCceecCeeecccccCCCCCCCCCHHHHHHHHHHHHHcCCCEEEChhhhCCCCcHHHHHHHHHhhcCCcceE
Confidence 78999999999999999999999877776678899999999999999999999999996568999999999976799999
Q ss_pred EEeccCcccCCCCCcccCCCHHHHHHHHHHHHhHcCCCcccEEEeecCCCCCCHHHHHHHHHHHHHcCCccEEEecCCCH
Q 040066 89 LATKFGIVKFDMSDVVVKGTPEYVRACCEASLKRLDVEYIDLYYQHRVDTTIPIEDTMGELKKLVEEGKIKYIGLSEASP 168 (202)
Q Consensus 89 i~tK~~~~~~~~~~~~~~~~~~~i~~~~~~sL~~Lg~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~vr~iGvsn~~~ 168 (202)
|+||+++.....+......+++.+++++++||++||+||||+|++|||+...+++++|++|++|+++|+||+||||||++
T Consensus 81 i~TK~~~~~~~~~~~~~~~~~~~i~~~~~~SL~rLg~dyiDl~~lH~p~~~~~~~e~~~al~~l~~~Gkir~iGvSn~~~ 160 (337)
T 3v0s_A 81 VGTKFGIHEIGFSGVKAXGTPDYVRSCCEASLKRLDVDYIDLFYIHRIDTTVPIEITMGELXXLVEEGKIXYVGLSEASP 160 (337)
T ss_dssp EEEEECEEEEETTEEEECCCHHHHHHHHHHHHHHHTCSCEEEEEESSCCTTSCHHHHHHHHHHHHHTTSEEEEEEESCCH
T ss_pred EEeeeccccCCCCcccCCCCHHHHHHHHHHHHHHhCCCCeeEEEecCCCCCCCHHHHHHHHHHHHHCCCeeEEeccCCCH
Confidence 99999875432222233568999999999999999999999999999999889999999999999999999999999999
Q ss_pred HHHHHHhcCCCeeEEcccCCcccccccccccCCC
Q 040066 169 DTIRRAHAVHPVTALQMEWSLWTREIEDEIVPLC 202 (202)
Q Consensus 169 ~~l~~~~~~~~~~~~q~~~n~~~~~~~~~ll~~~ 202 (202)
++++++.+..+++++|++||+++++.+.+++++|
T Consensus 161 ~~l~~~~~~~~~~~~Q~~~~~~~~~~e~~l~~~~ 194 (337)
T 3v0s_A 161 DTIRRAHAVHPVTALQIEYSLWTRDIEDEIVPLC 194 (337)
T ss_dssp HHHHHHHHHSCCCEEEEECBTTBCGGGTTHHHHH
T ss_pred HHHHHHhccCCceEEEeeccccccchhHHHHHHH
Confidence 9999999989999999999999999877888776
|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 | Back alignment and structure |
|---|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* | Back alignment and structure |
|---|
| >4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* | Back alignment and structure |
|---|
| >3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... | Back alignment and structure |
|---|
| >2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 202 | ||||
| d1pyfa_ | 311 | c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu | 2e-39 | |
| d1lqaa_ | 346 | c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: | 1e-37 | |
| d1pz1a_ | 333 | c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu | 2e-32 | |
| d3eaua1 | 326 | c.1.7.1 (A:36-361) Voltage-dependent K+ channel be | 2e-31 | |
| d1s1pa_ | 315 | c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak | 2e-29 | |
| d1vp5a_ | 284 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 9e-29 | |
| d1mi3a_ | 319 | c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu | 2e-28 | |
| d1us0a_ | 314 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 1e-27 | |
| d1qwka_ | 312 | c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod | 2e-27 | |
| d1afsa_ | 319 | c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase | 4e-27 | |
| d1hqta_ | 324 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 1e-26 | |
| d1ur3m_ | 298 | c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc | 1e-24 | |
| d1mzra_ | 274 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 6e-24 | |
| d1frba_ | 315 | c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce | 1e-23 | |
| d1gvea_ | 324 | c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) | 4e-20 | |
| d1hw6a_ | 262 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 8e-19 |
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Putative oxidoreductase IolS species: Bacillus subtilis [TaxId: 1423]
Score = 135 bits (339), Expect = 2e-39
Identities = 62/193 (32%), Positives = 101/193 (52%), Gaps = 3/193 (1%)
Query: 11 RVKLGGQGFEVSKLGFGCMGLTGIYNDP-VPVEVGISIIKHAFDQGITFFDTADVYGPNN 69
+ KLG +V +G G + G P + E G +++ A G+T DTA +YG
Sbjct: 2 KAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGR 61
Query: 70 ANELLVGKALKQLPREKVQLATKFGIVKFDMSDVVVKGTPEYVRACCEASLKRLDVEYID 129
+E L+G+ L++ RE V +ATK K V +P++++ + SLKRL+ +YID
Sbjct: 62 -SEELIGEVLREFNREDVVIATKAAHRKQGNDFVFDN-SPDFLKKSVDESLKRLNTDYID 119
Query: 130 LYYQHRVDTTIPIEDTMGELKKLVEEGKIKYIGLSEASPDTIRRAHAVHPVTALQMEWSL 189
L+Y H D P ++ + L ++ + GKI+ IG+S S + ++ A+ V LQ E++L
Sbjct: 120 LFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNL 179
Query: 190 WTREIEDEIVPLC 202
RE E P
Sbjct: 180 LNREAEKTFFPYT 192
|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| d1pyfa_ | 311 | Putative oxidoreductase IolS {Bacillus subtilis [T | 100.0 | |
| d1ur3m_ | 298 | Hypothetical oxidoreductase YdhF {Escherichia coli | 100.0 | |
| d1pz1a_ | 333 | Putative oxidoreductase YhdN {Bacillus subtilis [T | 100.0 | |
| d1gvea_ | 324 | Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus | 100.0 | |
| d1lqaa_ | 346 | Tas protein {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1hw6a_ | 262 | 2,5-diketo-D-gluconic acid reductase A {Corynebact | 100.0 | |
| d3eaua1 | 326 | Voltage-dependent K+ channel beta subunit {Rat (Ra | 100.0 | |
| d1qwka_ | 312 | Hypothetical protein C07D8.6 {Nematode (Caenorhabd | 100.0 | |
| d1mi3a_ | 319 | Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 | 100.0 | |
| d1vp5a_ | 284 | 2,5-diketo-D-gluconic acid reductase A {Thermotoga | 100.0 | |
| d1us0a_ | 314 | Aldose reductase (aldehyde reductase) {Human (Homo | 100.0 | |
| d1s1pa_ | 315 | Prostaglandin d2 11-ketoreductase (akr1c3) {Human | 100.0 | |
| d1afsa_ | 319 | 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus | 100.0 | |
| d1mzra_ | 274 | 2,5-diketo-D-gluconic acid reductase A {Escherichi | 100.0 | |
| d1hqta_ | 324 | Aldose reductase (aldehyde reductase) {Pig (Sus sc | 100.0 | |
| d1frba_ | 315 | FR-1 (fibroblast growth factor-induced) protein {M | 100.0 | |
| d1olta_ | 441 | Oxygen-independent coproporphyrinogen III oxidase | 82.52 |
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Putative oxidoreductase IolS species: Bacillus subtilis [TaxId: 1423]
Probab=100.00 E-value=9.4e-46 Score=305.38 Aligned_cols=191 Identities=32% Similarity=0.559 Sum_probs=173.9
Q ss_pred cceecCCCCccccceeeecccCCCC-CCCCCCHHHHHHHHHHHHHcCCCeeeCcCCcCCCChhHHHHHHHHhcCCCCCEE
Q 040066 10 PRVKLGGQGFEVSKLGFGCMGLTGI-YNDPVPVEVGISIIKHAFDQGITFFDTADVYGPNNANELLVGKALKQLPREKVQ 88 (202)
Q Consensus 10 ~~~~lg~~g~~vs~lg~Gt~~~~~~-~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~~g~~e~~lg~~l~~~~r~~~~ 88 (202)
++++||+||++||+||||||++|+. ++...+++++.++|++|++.|||+||||+.||. |.+|+.+|++++..+|++++
T Consensus 1 ~~~rLG~tgl~vS~iglGt~~~g~~~~~~~~~~~~a~~~l~~A~~~Gin~~DTA~~Yg~-g~sE~~lg~~l~~~~r~~~~ 79 (311)
T d1pyfa_ 1 KKAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGI-GRSEELIGEVLREFNREDVV 79 (311)
T ss_dssp CCEECTTSCCEECSBCEECTTSSCTTTCSSCCHHHHHHHHHHHHHTTCCEEECCTTTTT-THHHHHHHHHHTTSCGGGCE
T ss_pred CCcccCCCCCeecceeeeCcccCCCCCCCCCCHHHHHHHHHHHHHcCCCEEEehhhcCC-CccHHHHhhhhhccccccee
Confidence 3789999999999999999999863 345678999999999999999999999999998 89999999999988899999
Q ss_pred EEeccCcccCCCCCcccCCCHHHHHHHHHHHHhHcCCCcccEEEeecCCCCCCHHHHHHHHHHHHHcCCccEEEecCCCH
Q 040066 89 LATKFGIVKFDMSDVVVKGTPEYVRACCEASLKRLDVEYIDLYYQHRVDTTIPIEDTMGELKKLVEEGKIKYIGLSEASP 168 (202)
Q Consensus 89 i~tK~~~~~~~~~~~~~~~~~~~i~~~~~~sL~~Lg~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~vr~iGvsn~~~ 168 (202)
|+||++...... ....+.+++.|++++++||++|+++|+|++++|+|+...+.++++++|++|+++|+|++|||||++.
T Consensus 80 i~tK~~~~~~~~-~~~~~~~~~~i~~s~~~SL~rl~~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~Gkir~iGvs~~~~ 158 (311)
T d1pyfa_ 80 IATKAAHRKQGN-DFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSL 158 (311)
T ss_dssp EEEEECEEEETT-EEEECCCHHHHHHHHHHHHHHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHTTSBSCEEEESCCH
T ss_pred cceeccCCCCCc-ccccccchHHHHHHHHhhHHhhCCcHHhhhcccCCCcccchhhHHHHHHHHHhCCeEEeecccCCcH
Confidence 999998754432 2234668999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhcCCCeeEEcccCCcccccccccccCCC
Q 040066 169 DTIRRAHAVHPVTALQMEWSLWTREIEDEIVPLC 202 (202)
Q Consensus 169 ~~l~~~~~~~~~~~~q~~~n~~~~~~~~~ll~~~ 202 (202)
+.+.++.+..+++++|++||++++..+++++++|
T Consensus 159 ~~~~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~ 192 (311)
T d1pyfa_ 159 EQLKEANKDGLVDVLQGEYNLLNREAEKTFFPYT 192 (311)
T ss_dssp HHHHHHTTTSCCCEEEEECBTTBCGGGTTHHHHH
T ss_pred HHHHHHhhcCCcceEeeeecccchhhhHHHHHHH
Confidence 9999999999999999999999999887777654
|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|