Citrus Sinensis ID: 040083

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-----

VFRFKKFGDNGYPVEFDEAFRHNVEALLEFGQIHRNLCIGMPCWSFQLEVRRHPPFHVFLFVIEEPVEASMDHQCKHCRYVGWGHHMVCIKKYHFILPSKNMAAAYLNFQGNEGEDAGMLSNLMQLQGHAMHGVFHSNGFGHLLCVNGVETGSDLTGHQIMDFWDRLCSGLQARKVSLYDISRKKGMELRLLHVVAYSQSWFGHWGYKFGRGSFGVTQPMYQKAIEAIQGMPLCLLLNHLGHLNPDIPLIFTRYQTLSDHFLATLGDLFHFLLDLKSRLPKENCNFGSYNPGILVETNCRWSAKRVEMATRVIVESLKRAESRWVSRQEVRDVARSYVGDTGLLDFVLKSLGNHIVGKYLVRRSLNPVTKVLEYCLEDISNVFPEQDLVLGNSKTKTRYRISVAQLMKDVRILYKLILHDQKPATSSGIFSGISVASRIILDTKYFVKECCRDQVCSTKPGLDLEGKLKLYCTVILRDGENPNGGRSNSAMQPYECVTIKNNATFDELKLEVQRNFRELYWGLRSFVIESIVNVNATGTDLVCGFVEVGRRIVFEGSNSERGIVYGQIYENGMVNCVVECACGADEDDGERMVSCDICEVWQHTRCARIPNNEEIPHIFLCNRCEQEIVHLSSLP

ccccccccccccccccccHHHHHHHHHHHccccccccccccccEEEEEEEcccccEEEEEEEEECcccccccccccccEEEcccccccccccEEEEEEcccHHHHHHccccccccccHHHHcccccccccccEEEEccccccEEEEcccccccccccHHHHHHHHHHHHcccEEEEEEEEcccccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHcccHHHHHcccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHcccEEEccEEEEEEEcccccEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccEEEccccccccccccccccccEEEEEEEEEccccccccccccccccccCEEEEcccccHHHHHHHHHHHHHHHHHHHHcHHHcccccccccccccEEcccccccEEEEccccccccccccccccccccccEEEEEccccccccccEEEccccccccccccccccccccccccccccccccccccccccc

VFRFKKFGDNGYPVEFDEAFRHNVEALLEFGQIHRNLCIGMPCWSFQLEVRRHPPFHVFLFVIEEPVEASMDHQCKHCRYVGWGHHMVCIKKYHFILPSKNMAAAYLNFQGNEGEDAGMLSNLMQLQGHAMHGVFHSNGFGHLLCVNGVETGSDLTGHQIMDFWDRLCSGLQARKVSLYDISRKKGMELRLLHVVAYSQSWFGHWGYKFGRGSFGVTQPMYQKAIEAIQGMPLCLLLNHLGHLNPDIPLIFTRYQTLSDHFLATLGDLFHFLLDLKSRLP***************ETNCRWSAKRVEMATRVIVESLKRAESRWVSRQEVRDVARSYVGDTGLLDFVLKSLGNHIVGKYLVRRSLNPVTKVLEYCLEDISNV*************KTRYRISVAQLMKDVRILYKLILHDQKPATSSGIFSGISVASRIILDTKYFVKECCRDQVCSTKPGLDLEGKLKLYCTVILRD**************PYECVTIKNNATFDELKLEVQRNFRELYWGLRSFVIESIVNVNATGTDLVCGFVEVGRRIVFEGSNSERGIVYGQIYENGMVNCVVECACGADEDDGERMVSCDICEVWQHTRCARIPNNEEIPHIFLCNRCEQEIVH*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
PHD finger protein MALE STERILITY 1	Transcriptional activator required for anther and post-meiotic pollen development and maturation. Seems to regulate inflorescence branching and floral development. May control tapetal development by directly regulating tapetal programmed cell death (PCD) and breakdown. Implicated in pollen cytosolic components and wall development (e.g. exine and intine formation).	probable	Q9FMS5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WEE, chain A
Confidence level:very confident
Coverage over the Query: 565-632
View the alignment between query and template
View the model in PyMOL

Template: 2RNO, chain A
Confidence level:probable
Coverage over the Query: 508-557
View the alignment between query and template
View the model in PyMOL

Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 464-506
View the alignment between query and template
View the model in PyMOL