Citrus Sinensis ID: 040090

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MASQQGRKELDTRARQGETVVPGGTGGKSLEAQEHLAEGRSRGGQTRREQLGTEGYQEMGHRGGQMRREQMGSEGYQEMGRKGGLSTIDKSGGERAAEEGIEIDESKYKTSS
cccHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccccccccccccHHHHHcccccccHHHHcccHHHHHHccccccccccccccHHHHHcccccccccccccc
****************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASQQGRKELDTRARQGETVVPGGTGGKSLEAQEHLAEGRSRGGQTRREQLGTEGYQEMGHRGGQMRREQMGSEGYQEMGRKGGLSTIDKSGGERAAEEGIEIDESKYKTSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Embryonic abundant protein 1 Em protein may act as a cytoplasm protectant during desiccation.probableP46520
Em protein CS41 It is thought to provide protection for the cytoplasm during the desiccation stage of embryo development.probableP22701
Em protein H5 It is thought to provide protection for the cytoplasm during the desiccation stage of embryo development.probableP42755

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted