Citrus Sinensis ID: 040116


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MAMAALRREGRRFATPLISPRPIAAIRSPFLSEEDAPLGVRSISTQIVRNRMKSVKNIQKITKAMKMVAASKLRAIQVKAENSRGLWQPFTALLGDTPTVDAKKNVIVTISSDKGLCGGINSTAVKISKSLHKLNSDIELIITELQKNPLNYTQVSVLADDILKNVEFDALRIIYSKFHSVVSFLPTMATVLSPELVEREAESGGKLGELDSYEIEGGETKGEILQNLAEFQFSCVMFNAVLENACSEQGARMSAMDSSSRNAGEMLDRLTLTYNRTRQASITTELIEIISGASALEG
cHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccEEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEccccEEccccccEEEEEccccccHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccc
**************************************GVRSISTQIVRNRMKSVKNIQKITKAMKMVAASKLRAIQVKAENSRGLWQPFTALLGDTPTVDAKKNVIVTISSDKGLCGGINSTAVKISKSLHKLNSDIELIITELQKNPLNYTQVSVLADDILKNVEFDALRIIYSKFHSVVSFLPTMATVLSPEL*************LDSYEIEGGETKGEILQNLAEFQFSCVMFNAVLENACSEQGARMSAMDSSSRNAGEMLDRLTLTYNRTRQASITTELIEIISGASALE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMAALRREGRRFATPLISPRPIAAIRSPFLSEEDAPLGVRSISTQIVRNRMKSVKNIQKITKAMKMVAASKLRAIQVKAENSRGLWQPFTALLGDTPTVDAKKNVIVTISSDKGLCGGINSTAVKISKSLHKLNSDIELIITELQKNPLNYTQVSVLADDILKNVEFDALRIIYSKFHSVVSFLPTMATVLSPELVEREAESGGKLGELDSYEIEGGETKGEILQNLAEFQFSCVMFNAVLENACSEQGARMSAMDSSSRNAGEMLDRLTLTYNRTRQASITTELIEIISGASALEG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP synthase subunit gamma, mitochondrial Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.confidentQ96250
ATP synthase subunit gamma, mitochondrial Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.probableP26360
ATP synthase gamma chain Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex.probableA9WWS3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XOK, chain G
Confidence level:very confident
Coverage over the Query: 43-296
View the alignment between query and template
View the model in PyMOL