Citrus Sinensis ID: 040138


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MGKPLVSLASLSLLTFFCTISLPLYSNAISQCNGPCGTLDDCDGQLICINGKCNDDPDVGTHICKGGEGGGGGNCQPSGTLTCQGNSYPTYKCSPPVTSSTQARLTNNDFSEGGDGGGPSECDGQYHDNSKPIAALSTGWYSGGSRCGKMIRITANNGRSVLAQVVDECDSMRGCDEEHAGQPPCDNNIVDGSDAVWSALGLDKEIGIVDVTWSMS
ccccHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccEEEEcccccccccccEEECccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccEEEEEccccccccccccEEEEEEccccEEEEEEEEccccccccccccccccccccccccccHHHHHHHcccccccEEEEEEccc
*****VSLASLSLLTFFCTISLPLYSNAISQCNGPCGTLDDCDGQLICINGKCNDDPDVGTHIC*******************QGNSYPTYKCSPPVTSSTQARLTNNDFSEGGDGGGPSECDGQYHDNSKPIAALSTGWYSGGSRCGKMIRITANNGRSVLAQVVDECDSMRGCDEEHAGQPPCDNNIVDGSDAVWSALGLDKEIGIVDVTWSMS
xxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKPLVSLASLSLLTFFCTISLPLYSNAISQCNGPCGTLDDCDGQLICINGKCNDDPDVGTHICKGGEGGGGGNCQPSGTLTCQGNSYPTYKCSPPVTSSTQARLTNNDFSEGGDGGGPSECDGQYHDNSKPIAALSTGWYSGGSRCGKMIRITANNGRSVLAQVVDECDSMRGCDEEHAGQPPCDNNIVDGSDAVWSALGLDKEIGIVDVTWSMS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Kiwellin Kissper is an anion-selective pore-forming peptide.probableP84527
Putative ripening-related protein 2 probableQ6H5X0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HCZ, chain X
Confidence level:confident
Coverage over the Query: 100-215
View the alignment between query and template
View the model in PyMOL
Template: 1OIG, chain A
Confidence level:probable
Coverage over the Query: 35-55
View the alignment between query and template
View the model in PyMOL