Citrus Sinensis ID: 040193


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MAKLSFNNIFVFLLILSAALMAVRRVDAQVKRCEEKSNPNCSLEDCRAKCINKYINKRGFGECIENGAHTGYDCYCFWDC
ccccHHHHHHHHHHHHHHHHHHEEEccccEEEEEEcccccccHHHHHHHHHHHccccccEEEEEcccccccccEEEEEcc
cccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHcccEEcccEEccccccEEccccccccccEEEEEcc
MAKLSFNNIFVFLLILSAALMAVRRVDAQVKRceeksnpncsledCRAKCINKYINKrgfgeciengahtgydcycfwdc
MAKLSFNNIFVFLLILSAALMAVRRVDAQVKrceeksnpncsledcrAKCINKYINKRGFGECIENGAHTGYDCYCFWDC
MAKLSFNNIFVFLLILSAALMAVRRVDAQVKRCEEKSNPNCSLEDCRAKCINKYINKRGFGECIENGAHTGYDCYCFWDC
****SFNNIFVFLLILSAALMAVRRVDAQVKRCEEKSNPNCSLEDCRAKCINKYINKRGFGECIENGAHTGYDCYCFWD*
**KLSFNNIFVFLLILSAALMAVRRVDAQVKRCEEKSNPNCSLEDCRAKCINKYINKRGFGECIENGAHTGYDCYCFWDC
MAKLSFNNIFVFLLILSAALMAVRRVDAQVKRCEEKSNPNCSLEDCRAKCINKYINKRGFGECIENGAHTGYDCYCFWDC
**KLSFNNIFVFLLILSAALMAVRRVDAQVKRCEEKSNPNCSLEDCRAKCINKYINKRGFGECIENGAHTGYDCYCFWDC
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKLSFNNIFVFLLILSAALMAVRRVDAQVKRCEEKSNPNCSLEDCRAKCINKYINKRGFGECIENGAHTGYDCYCFWDC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query80 2.2.26 [Sep-21-2011]
Q9M0F177 Defensin-like protein 161 yes no 0.95 0.987 0.370 2e-05
P8272784 Putative defensin-like pr no no 0.862 0.821 0.342 4e-05
P8275078 Putative defensin-like pr no no 0.962 0.987 0.283 0.0004
P8273977 Defensin-like protein 159 no no 0.925 0.961 0.373 0.0005
>sp|Q9M0F1|DF161_ARATH Defensin-like protein 161 OS=Arabidopsis thaliana GN=LCR27 PE=3 SV=2 Back     alignment and function desciption
 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 1  MAKLSFNNIFVFLLILSAALMAVRRVDAQVKRCEEKSNPNCSLEDCRAKCINKYINKRGF 60
          MAKLS + + VF+L+ SA LM  +    + +   +K+ P C L DCR  C   Y    G 
Sbjct: 1  MAKLSCSYLLVFMLVFSAILMVEKVEGEECRLTIDKATP-CHLSDCRLSCYTGY---NGV 56

Query: 61 GECIENGAHTGYD-CYCFWDC 80
          GEC ++    G D C C ++C
Sbjct: 57 GECFDDPNVPGPDNCGCRYNC 77





Arabidopsis thaliana (taxid: 3702)
>sp|P82727|DF165_ARATH Putative defensin-like protein 165 OS=Arabidopsis thaliana GN=LCR12 PE=3 SV=1 Back     alignment and function description
>sp|P82750|DF154_ARATH Putative defensin-like protein 154 OS=Arabidopsis thaliana GN=LCR35 PE=3 SV=1 Back     alignment and function description
>sp|P82739|DF159_ARATH Defensin-like protein 159 OS=Arabidopsis thaliana GN=LCR25 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
35651715782 PREDICTED: uncharacterized protein LOC10 0.925 0.902 0.395 3e-06
356514747 214 PREDICTED: uncharacterized protein LOC10 0.925 0.345 0.395 3e-06
35651715982 PREDICTED: uncharacterized protein LOC10 0.925 0.902 0.395 1e-05
29779906077 low-molecular-weight cysteine-rich 27 [A 0.95 0.987 0.419 4e-05
4256724377 defensin-like protein 161 [Arabidopsis t 0.95 0.987 0.370 0.0008
35651730476 PREDICTED: putative defensin-like protei 0.875 0.921 0.369 0.0008
>gi|356517157|ref|XP_003527256.1| PREDICTED: uncharacterized protein LOC100801570 [Glycine max] Back     alignment and taxonomy information
 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 47/81 (58%), Gaps = 7/81 (8%)

Query: 1  MAKLSFNNIFVFLLILSAALMAVRRVDAQVKRCEEKSNP-NCSLEDCRAKCINKYINKRG 59
          MAKLSF  IF+  LI+      V    ++  RC++   P NC+L  C+A C  +Y + RG
Sbjct: 1  MAKLSFAQIFMVTLII-----LVISKTSEADRCQKVIQPSNCNLGKCQADCSFQYRDYRG 55

Query: 60 FGECIENGAHTGYDCYCFWDC 80
           G+CI  G++  + C CF+DC
Sbjct: 56 IGKCI-GGSNATFQCVCFYDC 75




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356514747|ref|XP_003526065.1| PREDICTED: uncharacterized protein LOC100795894 [Glycine max] Back     alignment and taxonomy information
>gi|356517159|ref|XP_003527257.1| PREDICTED: uncharacterized protein LOC100802095 [Glycine max] Back     alignment and taxonomy information
>gi|297799060|ref|XP_002867414.1| low-molecular-weight cysteine-rich 27 [Arabidopsis lyrata subsp. lyrata] gi|297313250|gb|EFH43673.1| low-molecular-weight cysteine-rich 27 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42567243|ref|NP_194659.2| defensin-like protein 161 [Arabidopsis thaliana] gi|114152833|sp|Q9M0F1.2|DF161_ARATH RecName: Full=Defensin-like protein 161; AltName: Full=Low-molecular-weight cysteine-rich protein 27; Short=Protein LCR27; Flags: Precursor gi|332660215|gb|AEE85615.1| defensin-like protein 161 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356517304|ref|XP_003527328.1| PREDICTED: putative defensin-like protein 154-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
TAIR|locus:211823977 LCR27 "AT4G29300" [Arabidopsis 0.937 0.974 0.402 9.7e-09
TAIR|locus:100902331377 LCR25 "low-molecular-weight cy 0.912 0.948 0.380 8.7e-08
TAIR|locus:100902346284 LCR12 "low-molecular-weight cy 0.837 0.797 0.351 8.7e-08
TAIR|locus:211822477 LCR26 "AT4G29290" [Arabidopsis 0.912 0.948 0.369 3.8e-07
TAIR|locus:100902323578 LCR35 "low-molecular-weight cy 0.962 0.987 0.283 2.6e-06
TAIR|locus:100902321879 LCR14 "low-molecular-weight cy 0.925 0.936 0.333 7e-06
TAIR|locus:100902331977 LCR23 "low-molecular-weight cy 0.937 0.974 0.292 3e-05
TAIR|locus:100902339578 LCR3 "low-molecular-weight cys 0.85 0.871 0.293 3e-05
TAIR|locus:50500653376 LCR24 "low-molecular-weight cy 0.925 0.973 0.292 5e-05
TAIR|locus:211821477 LCR22 "low-molecular-weight cy 0.937 0.974 0.292 0.00013
TAIR|locus:2118239 LCR27 "AT4G29300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 131 (51.2 bits), Expect = 9.7e-09, P = 9.7e-09
 Identities = 33/82 (40%), Positives = 46/82 (56%)

Query:     1 MAKLSFNNIFVFLLILSAALMAVRRVDAQVKRCE-EKSNPNCSLEDCRAKCINKYINKRG 59
             MAKLS + + VF+L+ SA LM V +V+ +  R   +K+ P C L DCR  C   Y    G
Sbjct:     1 MAKLSCSYLLVFMLVFSAILM-VEKVEGEECRLTIDKATP-CHLSDCRLSCYTGY---NG 55

Query:    60 FGECIENGAHTGYD-CYCFWDC 80
              GEC ++    G D C C ++C
Sbjct:    56 VGECFDDPNVPGPDNCGCRYNC 77




GO:0003674 "molecular_function" evidence=ND
GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:1009023313 LCR25 "low-molecular-weight cysteine-rich 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023462 LCR12 "low-molecular-weight cysteine-rich 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118224 LCR26 "AT4G29290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023235 LCR35 "low-molecular-weight cysteine-rich 35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023218 LCR14 "low-molecular-weight cysteine-rich 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023319 LCR23 "low-molecular-weight cysteine-rich 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023395 LCR3 "low-molecular-weight cysteine-rich 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006533 LCR24 "low-molecular-weight cysteine-rich 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118214 LCR22 "low-molecular-weight cysteine-rich 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M0F1DF161_ARATHNo assigned EC number0.37030.950.9870yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

No confident hit detected by STRING


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 80
PF0733358 SLR1-BP: S locus-related glycoprotein 1 binding po 99.69
PF1086890 DUF2667: Protein of unknown function (DUF2667); In 97.97
PF0045132 Toxin_2: Scorpion short toxin, BmKK2; InterPro: IP 90.64
PF0712754 Nodulin_late: Late nodulin protein; InterPro: IPR0 90.38
PF0030447 Gamma-thionin: Gamma-thionin family; InterPro: IPR 88.91
PF1260650 RELT: Tumour necrosis factor receptor superfamily 88.64
PF1141535 Toxin_37: Antifungal peptide termicin; InterPro: I 87.54
PF15240 179 Pro-rich: Proline-rich 86.75
>PF07333 SLR1-BP: S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP); InterPro: IPR010851 This entry consists of a number of cysteine rich SLR1 binding pollen coat like proteins Back     alignment and domain information
Probab=99.69  E-value=2.8e-17  Score=94.98  Aligned_cols=54  Identities=33%  Similarity=0.837  Sum_probs=46.9

Q ss_pred             hhhhcccccccccccc---ccCChhhHHHHhHhhccCCCee-eEEeeCCCCCCcceeEeecC
Q 040193           23 VRRVDAQVKRCEEKSN---PNCSLEDCRAKCINKYINKRGF-GECIENGAHTGYDCYCFWDC   80 (80)
Q Consensus        23 ~~~~qg~~~~C~~~i~---~~C~~~~C~~~C~~k~~~~~G~-G~C~~~~~~~~~~C~C~Y~C   80 (80)
                      |+|+|||+.+|+++|+   ++|+.++|+++|.++|   +|. |+|+++ ++++.+|+|+|+|
T Consensus         1 ~~etqg~~~~C~~~l~~~~~~C~~~~C~~~C~~k~---~g~~G~C~~~-~~~~~~C~C~Y~C   58 (58)
T PF07333_consen    1 VKETQGQERQCHEVLPNKPGPCDPQDCRSLCKKKY---KGGVGTCIPK-PKGPKQCLCTYNC   58 (58)
T ss_pred             CCcccCCCCcCceeCccCCCCCChHHHHHHHHHHc---CCCceEeccC-CCCCCeeEEEeeC
Confidence            5899999556999998   6899999999999999   665 999993 3468899999998



Adhesion of pollen grains to the stigmatic surface is a critical step during sexual reproduction in plants. In Brassica, S locus-related glycoprotein 1 (SLR1), a stigma-specific protein belonging to the S gene family of proteins, has been shown to be involved in this step. SLR1-BP specifically binds SLR1 with high affinity. The SLR1-BP gene is specifically expressed in pollen at late stages of development and is a member of the class A pollen coat protein (PCP) family, which includes PCP-A1, an SLG (S locus glycoprotein)-binding protein []. This entry also includes defensin-like proteins. The function of these proteins is uncharacterised.

>PF10868 DUF2667: Protein of unknown function (DUF2667); InterPro: IPR022618 This family of proteins with unknown function appears to be restricted to Arabidopsis thaliana Back     alignment and domain information
>PF00451 Toxin_2: Scorpion short toxin, BmKK2; InterPro: IPR001947 Scorpion venoms contain a variety of peptides toxic to mammals, insects and crustaceans Back     alignment and domain information
>PF07127 Nodulin_late: Late nodulin protein; InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein Back     alignment and domain information
>PF00304 Gamma-thionin: Gamma-thionin family; InterPro: IPR008176 The following small plant proteins are evolutionary related: Gamma-thionins from Triticum aestivum (Wheat) endosperm (gamma-purothionins) and gamma-hordothionins from Hordeum vulgare(Barley) are toxic to animal cells and inhibit protein synthesis in cell free systems [] Back     alignment and domain information
>PF12606 RELT: Tumour necrosis factor receptor superfamily member 19; InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis) Back     alignment and domain information
>PF11415 Toxin_37: Antifungal peptide termicin; InterPro: IPR024723 Termicin is a cysteine-rich antifungal peptide, which also exhibits weak antibacterial activity Back     alignment and domain information
>PF15240 Pro-rich: Proline-rich Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
1wt7_A41 BUTX-MTX; maurotoxin, butantoxin, scorpion toxin, 96.62
2ddl_A33 Leiurotoxin, LEI4P; scorpion toxin analog; NMR {Sy 96.58
1qky_A38 PI7, toxin 7 from pandinus imperator; neurotoxin; 96.09
1c49_A35 Toxin K-beta; scorpion toxin, potassium channels b 96.05
1n8m_A38 PI4, potassium channel blocking toxin 4; potassium 96.01
1quz_A35 HSTX1 toxin; scorpion toxin, alpha beta, molecular 96.0
1r1g_A31 Neurotoxin BMK37, BMBKTTX1; siras from S atoms, sc 95.05
1wmt_A41 ISTX; neurotoxin, potassium channel blocker, solut 94.85
1pjv_A32 Cobatoxin 1, COTX1, GTIX; scorpion toxin, centuroi 94.15
1c55_A40 Butantoxin; structure; NMR {Tityus serrulatus} SCO 93.63
2k9o_A36 VM24 scorpion toxin; ALFA/beta scaffold, beta shee 93.05
1big_A37 Toxin BMTX1; scorpion, neurotoxin, structure, larg 92.41
1hly_A39 Hongotoxin 1; scorpion, centruroides limbatus HGTX 91.84
1hp2_A37 Tityustoxin K alpha; K+ channel, scorpion toxin, a 91.8
1mm0_A36 Termicin; termite, cytein-rich, antimicrobial pept 91.12
1j5j_A36 BEKM-1 toxin; alpha-beta motif, cysteine-knot moti 91.04
2axk_A38 Discrepin; scorpion toxin, A-current, K+-channel,; 90.9
1m2s_A37 Toxin BMTX3, neurotoxin TX3; alpha/beta scaffold; 90.68
1wz5_A35 Potassium channel blocking toxin 1; ionic channel 90.11
1brz_A54 Brazzein; sweet protein, cysteine-stabilized alpha 89.91
1bah_A37 Charybdotoxin, chabii; neurotoxin, potassium chann 89.56
3psm_A47 Defensin, SPE10; dimer, antimicrobial protein; 0.9 88.13
2kpy_A108 Major pollen allergen ART V 1; defensin-like, poly 88.04
1agt_A38 Agitoxin 2; potassium channel blocker, neurotoxin; 86.64
2koz_A33 Nasonin-1; alpha/beta structure, disulfide bonds, 85.92
1ayj_A51 RS-AFP1, antifungal protein 1; fungicide, plant de 85.21
2ksk_A71 Sugarcane defensin 5; csalphabeta motif, antimicro 85.1
1jxc_A68 Putative trypsin inhibitor ATTI-2; chymotrypsin in 84.02
1cmr_A31 Charybdotoxin, alpha chimera; antagonist of nicoti 83.95
1tsk_A35 TS KAPA; scorpion, toxin, potassium channel, neuro 83.84
1gps_A47 Gamma-1-P thionin; plant toxin; NMR {Triticum turg 83.79
1n4n_A47 PHD1, floral defensin-like protein 1; cysteine-sta 83.68
1mr4_A47 Nicotiana alata plant defensin 1 (NAD1); cysteine- 83.27
1ti5_A46 Plant defensin; insecticidal activity, MUNG bean, 80.68
1jkz_A46 PSD1, defense-related peptide 1; plant defensin, C 80.3
>1wt7_A BUTX-MTX; maurotoxin, butantoxin, scorpion toxin, K+ channels, molecular contacts, toxin affinity; NMR {Synthetic} SCOP: g.3.7.2 PDB: 2z3s_A Back     alignment and structure
Probab=96.62  E-value=0.0023  Score=34.03  Aligned_cols=35  Identities=29%  Similarity=0.771  Sum_probs=27.2

Q ss_pred             ccccCCh-hhHHHHhHhhccCCCeeeEEeeCCCCCCcceeEeecC
Q 040193           37 SNPNCSL-EDCRAKCINKYINKRGFGECIENGAHTGYDCYCFWDC   80 (80)
Q Consensus        37 i~~~C~~-~~C~~~C~~k~~~~~G~G~C~~~~~~~~~~C~C~Y~C   80 (80)
                      ++-.|.. .+|...|.+++  +...|+|++.      .|.| |+|
T Consensus         6 ~~vkC~~s~~C~~~Ck~~~--g~~~gKCmNg------kC~C-y~c   41 (41)
T 1wt7_A            6 LDLACTGSKDCYAPCRKQT--GCPNAKCINK------SCKC-YGC   41 (41)
T ss_dssp             SCCTTSCHHHHHHHHHHHH--SCCCEEEETT------EEEE-CCC
T ss_pred             eccccCCchHHHHHHHHHh--CCCCCceeCC------Cccc-cCC
Confidence            4434776 57999999997  4678999987      6999 666



>2ddl_A Leiurotoxin, LEI4P; scorpion toxin analog; NMR {Synthetic} Back     alignment and structure
>1qky_A PI7, toxin 7 from pandinus imperator; neurotoxin; NMR {Pandinus imperator} SCOP: g.3.7.2 Back     alignment and structure
>1c49_A Toxin K-beta; scorpion toxin, potassium channels blockers, alpha-K toxin family, neurotoxin, solution structure; NMR {Pandinus imperator} SCOP: g.3.7.2 PDB: 2pta_A Back     alignment and structure
>1n8m_A PI4, potassium channel blocking toxin 4; potassium channel blocker, disulfide bridge stabilized alpha beta motif; NMR {Synthetic} SCOP: g.3.7.2 PDB: 1v56_A 1txm_A Back     alignment and structure
>1quz_A HSTX1 toxin; scorpion toxin, alpha beta, molecular modeling, potassium channel; NMR {Synthetic} SCOP: k.23.1.1 PDB: 1y2p_A 1wpd_A Back     alignment and structure
>1r1g_A Neurotoxin BMK37, BMBKTTX1; siras from S atoms, scorpion toxin, reductive dimethylation; HET: MLY; 1.72A {Synthetic} SCOP: g.3.7.2 PDB: 1q2k_A 3e8y_X Back     alignment and structure
>1wmt_A ISTX; neurotoxin, potassium channel blocker, solution structure, alpha-K toxin family, scorpion toxin; NMR {Synthetic} SCOP: g.3.7.2 Back     alignment and structure
>1pjv_A Cobatoxin 1, COTX1, GTIX; scorpion toxin, centuroides noxius, K+ channel, chemical synthesis, 3-D structure, 1H-spectroscopy, circular dichroism; NMR {Synthetic} SCOP: g.3.7.2 Back     alignment and structure
>1c55_A Butantoxin; structure; NMR {Tityus serrulatus} SCOP: g.3.7.2 PDB: 1c56_A Back     alignment and structure
>2k9o_A VM24 scorpion toxin; ALFA/beta scaffold, beta sheet, ALFA helix, scorpion K+ toxin; NMR {Synthetic} Back     alignment and structure
>1big_A Toxin BMTX1; scorpion, neurotoxin, structure, large conductance potassium channel, voltage gated potassium channel; HET: PCA; NMR {Mesobuthus martensii} SCOP: g.3.7.2 PDB: 2bmt_A* Back     alignment and structure
>1hly_A Hongotoxin 1; scorpion, centruroides limbatus HGTX1, potassium channel; NMR {Centruroides limbatus} SCOP: g.3.7.2 PDB: 1mtx_A 1sxm_A Back     alignment and structure
>1hp2_A Tityustoxin K alpha; K+ channel, scorpion toxin, alpha-K toxin,; NMR {Tityus serrulatus} SCOP: g.3.7.2 Back     alignment and structure
>1mm0_A Termicin; termite, cytein-rich, antimicrobial peptide, insect defensin, CSAB motif, antimicrobial protein; NMR {Pseudacanthotermes spiniger} SCOP: g.3.7.4 Back     alignment and structure
>1j5j_A BEKM-1 toxin; alpha-beta motif, cysteine-knot motif; NMR {Mesobuthus eupeus} SCOP: g.3.7.2 PDB: 1lgl_A Back     alignment and structure
>2axk_A Discrepin; scorpion toxin, A-current, K+-channel,; HET: PCA; NMR {Synthetic} Back     alignment and structure
>1m2s_A Toxin BMTX3, neurotoxin TX3; alpha/beta scaffold; NMR {Mesobuthus martensii} SCOP: g.3.7.2 Back     alignment and structure
>1wz5_A Potassium channel blocking toxin 1; ionic channel inhibitor; HET: ABA; NMR {Pandinus imperator} Back     alignment and structure
>1brz_A Brazzein; sweet protein, cysteine-stabilized alpha-beta; HET: PCA; NMR {Pentadiplandra brazzeana} SCOP: g.3.7.5 PDB: 2brz_A* 2kgq_A 2kyq_A Back     alignment and structure
>1bah_A Charybdotoxin, chabii; neurotoxin, potassium channel inhibitor; HET: PCA ABA; NMR {Leiurus quinquestriatus} SCOP: g.3.7.2 PDB: 2a9h_E* 2crd_A* 1lir_A* Back     alignment and structure
>3psm_A Defensin, SPE10; dimer, antimicrobial protein; 0.98A {Pachyrhizus erosus} SCOP: g.3.7.5 PDB: 2gl1_A 2lj7_A Back     alignment and structure
>2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Back     alignment and structure
>1agt_A Agitoxin 2; potassium channel blocker, neurotoxin; NMR {Leiurus quinquestriatus hebraeus} SCOP: g.3.7.2 PDB: 1xsw_A 2ktx_A 2uvs_A 3odv_A* 1ktx_A 2ck4_A 1sco_A 2k4u_A 1bkt_A 2ck5_A 2kir_A Back     alignment and structure
>2koz_A Nasonin-1; alpha/beta structure, disulfide bonds, de novo protein; NMR {Synthetic construct} PDB: 2kp0_A Back     alignment and structure
>1ayj_A RS-AFP1, antifungal protein 1; fungicide, plant defensin, cysteine-stabilized ALFA/beta motif; HET: PCA; NMR {Raphanus sativus var} SCOP: g.3.7.5 Back     alignment and structure
>2ksk_A Sugarcane defensin 5; csalphabeta motif, antimicrobial protein; NMR {Saccharum officinarum} Back     alignment and structure
>1jxc_A Putative trypsin inhibitor ATTI-2; chymotrypsin inhibitor, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: g.3.7.5 Back     alignment and structure
>1cmr_A Charybdotoxin, alpha chimera; antagonist of nicotinic acetylcholine receptor, curaremimetic protein; NMR {Synthetic} SCOP: g.3.7.2 Back     alignment and structure
>1tsk_A TS KAPA; scorpion, toxin, potassium channel, neurotoxin; NMR {Tityus serrulatus} SCOP: g.3.7.2 Back     alignment and structure
>1gps_A Gamma-1-P thionin; plant toxin; NMR {Triticum turgidum} SCOP: g.3.7.5 PDB: 1gpt_A Back     alignment and structure
>1n4n_A PHD1, floral defensin-like protein 1; cysteine-stabilised alpha-beta motif, fifth disulfide bond, plant protein; NMR {Petunia x hybrida} SCOP: g.3.7.5 Back     alignment and structure
>1mr4_A Nicotiana alata plant defensin 1 (NAD1); cysteine-stabilized alpha-beta motif, plant defensin fold, plant protein; NMR {Nicotiana tabacum} SCOP: g.3.7.5 PDB: 4aaz_A 4ab0_A Back     alignment and structure
>1ti5_A Plant defensin; insecticidal activity, MUNG bean, plant protein; NMR {Vigna radiata} Back     alignment and structure
>1jkz_A PSD1, defense-related peptide 1; plant defensin, Cys-rich, antifungal, antifungal protein; NMR {Pisum sativum} SCOP: g.3.7.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
d1ayja_51 Antifungal protein 1 (RS-AFP1) {Radish (Raphanus s 92.02
d1brza_54 Brazzein {J'oublie (Pentadiplandra brazzeana) [Tax 91.66
d1r1ga_31 Neurotoxin bmk37 {Chinese scorpion (Buthus martens 90.62
d1mm0a_36 Antimicrobial peptide termicin {Termite (Pseudacan 90.5
d1wmta_41 Istx {Scorpion (Opisthacanthus madagascariensis) [ 90.16
d1bk8a_50 Antimicrobial protein 1 (AH-AMP1) {Horse chestnut 89.82
d1c55a_40 Butantoxin {Brazilian scorpion (Tityus serrulatus) 87.45
d1jlza_26 alpha-KTX, K+-channel blocker {Scorpion (Tityus ca 85.95
d1j5ja_36 Bekm-1 {Lesser asian scorpion (Buthus eupeus) [Tax 83.96
d1gpsa_47 gamma-Thionin {English wheat (Triticum turgidum) [ 83.48
d1jxca_68 Trypsin/chymotrypsin inhibitor ATT {Mouse-ear cres 83.25
d1pjva_32 Cobatoxin 1 {Scorpion (Centruroides noxius) [TaxId 83.01
d1biga_37 Bmtx1 {Buthus martensii [TaxId: 34649]} 82.44
d1m2sa_37 Bmtx3 {Buthus martensii karsch [TaxId: 34649]} 82.04
d2crda_37 Charybdotoxin {Scorpion (Leiurus quinquestriatus h 81.63
>d1ayja_ g.3.7.5 (A:) Antifungal protein 1 (RS-AFP1) {Radish (Raphanus sativus) [TaxId: 3726]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: Scorpion toxin-like
family: Plant defensins
domain: Antifungal protein 1 (RS-AFP1)
species: Radish (Raphanus sativus) [TaxId: 3726]
Probab=92.02  E-value=0.16  Score=26.62  Aligned_cols=40  Identities=28%  Similarity=0.675  Sum_probs=29.7

Q ss_pred             ccccCCh-hhHHHHhHhhccCCCeeeEEeeCCCCCCcceeEeecC
Q 040193           37 SNPNCSL-EDCRAKCINKYINKRGFGECIENGAHTGYDCYCFWDC   80 (80)
Q Consensus        37 i~~~C~~-~~C~~~C~~k~~~~~G~G~C~~~~~~~~~~C~C~Y~C   80 (80)
                      |..+|.. +.|+..|..-.  +---|.|-...+  ...|+|+|+|
T Consensus        11 WsG~Cgn~~~C~~qC~~~E--~A~hGaCh~~f~--~~~CfCYF~C   51 (51)
T d1ayja_          11 WSGVCGNNNACKNQCINLE--KARHGSCNYVFP--AHKCICYFPC   51 (51)
T ss_dssp             CCSCCSCHHHHHHHHHHHS--CCSCEEEECCSS--SCEEEEEECC
T ss_pred             eeeccCCchHHHHHHHhhh--hccccccccccC--CccEEEeccC
Confidence            4467886 67999999754  134699976543  4579999998



>d1brza_ g.3.7.5 (A:) Brazzein {J'oublie (Pentadiplandra brazzeana) [TaxId: 43545]} Back     information, alignment and structure
>d1r1ga_ g.3.7.2 (A:) Neurotoxin bmk37 {Chinese scorpion (Buthus martensi karsch) [TaxId: 34649]} Back     information, alignment and structure
>d1mm0a_ g.3.7.4 (A:) Antimicrobial peptide termicin {Termite (Pseudacanthotermes spiniger) [TaxId: 115113]} Back     information, alignment and structure
>d1wmta_ g.3.7.2 (A:) Istx {Scorpion (Opisthacanthus madagascariensis) [TaxId: 167108]} Back     information, alignment and structure
>d1bk8a_ g.3.7.5 (A:) Antimicrobial protein 1 (AH-AMP1) {Horse chestnut (Aesculus hippocastanum) [TaxId: 43364]} Back     information, alignment and structure
>d1c55a_ g.3.7.2 (A:) Butantoxin {Brazilian scorpion (Tityus serrulatus) [TaxId: 6887]} Back     information, alignment and structure
>d1jlza_ g.3.7.2 (A:) alpha-KTX, K+-channel blocker {Scorpion (Tityus cambridgei) [TaxId: 184226]} Back     information, alignment and structure
>d1j5ja_ g.3.7.2 (A:) Bekm-1 {Lesser asian scorpion (Buthus eupeus) [TaxId: 34648]} Back     information, alignment and structure
>d1gpsa_ g.3.7.5 (A:) gamma-Thionin {English wheat (Triticum turgidum) [TaxId: 4571]} Back     information, alignment and structure
>d1jxca_ g.3.7.5 (A:) Trypsin/chymotrypsin inhibitor ATT {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pjva_ g.3.7.2 (A:) Cobatoxin 1 {Scorpion (Centruroides noxius) [TaxId: 6878]} Back     information, alignment and structure
>d1biga_ g.3.7.2 (A:) Bmtx1 {Buthus martensii [TaxId: 34649]} Back     information, alignment and structure
>d1m2sa_ g.3.7.2 (A:) Bmtx3 {Buthus martensii karsch [TaxId: 34649]} Back     information, alignment and structure
>d2crda_ g.3.7.2 (A:) Charybdotoxin {Scorpion (Leiurus quinquestriatus hebraeus) [TaxId: 6884]} Back     information, alignment and structure