Citrus Sinensis ID: 040208


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MISTFISGQVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYHHIPLNADCQSLQPKVINIDEEAAGNSSGEDINATKA
ccccHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccccccccccEEEccccccccccccccccccc
**STFISGQVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYHHIPLNADCQSLQPKVINI******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISTFISGQVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYHHIPLNADCQSLQPKVINIDEEAAGNSSGEDINATKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methionine S-methyltransferase Catalyzes the S-methylmethionine (SMM) biosynthesis from adenosyl-L-homocysteine (AdoMet) and methionine. SMM biosynthesis (by MMT1) and degradation (by HMT-1, HMT-2 and HMT-3) constitute the SMM cycle in plants, which is probably required to achieve short term control of AdoMet level. Also able to catalyze the selenium-methylmethionine (SeMM) from AdoMet and selenium-methionine (SeMet). May play a role in phoem sulfur transport; such function is however not essential.probableQ9LTB2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G0T, chain A
Confidence level:probable
Coverage over the Query: 3-106
View the alignment between query and template
View the model in PyMOL