Citrus Sinensis ID: 040208

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MISTFISGQVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYHHIPLNADCQSLQPKVINIDEEAAGNSSGEDINATKA
ccccHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccccEEEccccccccccccccccccc
ccEEEEcHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccccEEEEcEEEEEcHHHcccccccccccccc
MISTFISGQVKKIFEFLKNGFyeisssldlyfeddlvadekiPFLACLASALkehsffpyeppagtkRFQNLIADFMKMyhhiplnadcqslqpkvinideeaagnssgedinatka
MISTFISGQVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYHHIPLNADCQSLQPKVINIDEeaagnssgedinatka
MISTFISGQVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYHHIPLNADCQSLQPKVINIDEEAAGNSSGEDINATKA
****FISGQVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYHHIPLNADCQSLQPKVIN*******************
**STF**GQVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYHHIPLNADCQSLQPKVINI******************
MISTFISGQVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYHHIPLNADCQSLQPKVINIDEEAA*************
MISTFISGQVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYHHIPLNADCQSLQPKVINIDEE***************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISTFISGQVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYHHIPLNADCQSLQPKVINIDEEAAGNSSGEDINATKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query117 2.2.26 [Sep-21-2011]
Q9SWR3 1088 Methionine S-methyltransf N/A no 0.735 0.079 0.697 1e-29
Q9LTB2 1071 Methionine S-methyltransf yes no 0.675 0.073 0.721 2e-27
Q9MBC2 1088 Methionine S-methyltransf N/A no 0.683 0.073 0.712 4e-26
Q8W519 1091 Methionine S-methyltransf N/A no 0.683 0.073 0.7 3e-25
>sp|Q9SWR3|MMT1_WOLBI Methionine S-methyltransferase OS=Wollastonia biflora GN=MMT1 PE=1 SV=1 Back     alignment and function desciption
 Score =  127 bits (320), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 60/86 (69%), Positives = 71/86 (82%)

Query: 9   QVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKR 68
           +VKKIFEFLKNGF++IS+SLDL FEDD VADEKIPFLA LA  LK+ S FPYEPP G KR
Sbjct: 376 EVKKIFEFLKNGFHDISNSLDLSFEDDSVADEKIPFLAYLAGVLKDGSRFPYEPPTGNKR 435

Query: 69  FQNLIADFMKMYHHIPLNADCQSLQP 94
           F++LIA FMK YHH+PL+ D  ++ P
Sbjct: 436 FRDLIASFMKTYHHVPLSTDNVAIFP 461
Catalyzes the S-methylmethionine (SMM) biosynthesis from adenosyl-L-homocysteine (AdoMet) and methionine. SMM biosynthesis (by MMT1) and degradation (by HMT-1, HMT-2 and HMT-3) constitute the SMM cycle in plants, which is probably required to achieve short term control of AdoMet level. Also able to catalyze the selenium-methylmethionine (SeMM) from AdoMet and selenium-methionine (SeMet). May play a role in phoem sulfur transport; such function is however not essential.
Wollastonia biflora (taxid: 101473)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 2
>sp|Q9LTB2|MMT1_ARATH Methionine S-methyltransferase OS=Arabidopsis thaliana GN=MMT1 PE=2 SV=1 Back     alignment and function description
>sp|Q9MBC2|MMT1_HORVU Methionine S-methyltransferase OS=Hordeum vulgare GN=MMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q8W519|MMT1_MAIZE Methionine S-methyltransferase OS=Zea mays GN=MMT1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
297739444 1089 unnamed protein product [Vitis vinifera] 0.683 0.073 0.812 6e-32
225465288 1092 PREDICTED: methionine S-methyltransferas 0.683 0.073 0.812 6e-32
147856453 1098 hypothetical protein VITISV_013862 [Viti 0.683 0.072 0.812 7e-32
92893696 1098 SAM (and some other nucleotide) binding 0.675 0.071 0.822 2e-30
357445181 1092 Methionine S-methyltransferase [Medicago 0.675 0.072 0.822 2e-30
224129814 1095 methionine s-methyltransferase [Populus 0.683 0.073 0.775 1e-29
50401195 1088 RecName: Full=Methionine S-methyltransfe 0.735 0.079 0.697 6e-28
356559151 1091 PREDICTED: methionine S-methyltransferas 0.683 0.073 0.75 1e-27
255569806 1001 Methionine S-methyltransferase, putative 0.683 0.079 0.762 3e-27
356541838 1090 PREDICTED: methionine S-methyltransferas 0.683 0.073 0.762 3e-27
>gi|297739444|emb|CBI29626.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%)

Query: 9   QVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKR 68
           QVK IFEFLKNGF+EISSSLDL+FEDD VADEKIPFLA LAS LK +SFFPYEPPAG+KR
Sbjct: 368 QVKTIFEFLKNGFHEISSSLDLFFEDDSVADEKIPFLAYLASVLKGNSFFPYEPPAGSKR 427

Query: 69  FQNLIADFMKMYHHIPLNAD 88
           F+NLIA FM+ YHH+P+NAD
Sbjct: 428 FRNLIAGFMRTYHHVPVNAD 447

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225465288|ref|XP_002270977.1| PREDICTED: methionine S-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147856453|emb|CAN80765.1| hypothetical protein VITISV_013862 [Vitis vinifera] Back     alignment and taxonomy information
>gi|92893696|gb|ABE91874.1| SAM (and some other nucleotide) binding motif [Medicago truncatula] Back     alignment and taxonomy information
>gi|357445181|ref|XP_003592868.1| Methionine S-methyltransferase [Medicago truncatula] gi|355481916|gb|AES63119.1| Methionine S-methyltransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|224129814|ref|XP_002328809.1| methionine s-methyltransferase [Populus trichocarpa] gi|222839107|gb|EEE77458.1| methionine s-methyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|50401195|sp|Q9SWR3.1|MMT1_WOLBI RecName: Full=Methionine S-methyltransferase; AltName: Full=AdoMet:Met S-methyltransferase gi|5733427|gb|AAD49573.1| methionine S-methyltransferase [Wedelia biflora] Back     alignment and taxonomy information
>gi|356559151|ref|XP_003547864.1| PREDICTED: methionine S-methyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|255569806|ref|XP_002525867.1| Methionine S-methyltransferase, putative [Ricinus communis] gi|223534872|gb|EEF36561.1| Methionine S-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356541838|ref|XP_003539379.1| PREDICTED: methionine S-methyltransferase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
TAIR|locus:2155466 1071 MMT "methionine S-methyltransf 0.675 0.073 0.721 1e-24
TAIR|locus:2155466 MMT "methionine S-methyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 294 (108.6 bits), Expect = 1.0e-24, P = 1.0e-24
 Identities = 57/79 (72%), Positives = 66/79 (83%)

Query:    10 VKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRF 69
             VK IF+FLKNGF EIS+SLDL FED+ VADEKIPFLA LAS LK  S+FP+EPPAG+KRF
Sbjct:   368 VKIIFDFLKNGFQEISNSLDLSFEDETVADEKIPFLAYLASVLKNSSYFPFEPPAGSKRF 427

Query:    70 QNLIADFMKMYHHIPLNAD 88
              +LIA FM+ YH IP+N D
Sbjct:   428 CSLIAGFMRTYHRIPINQD 446


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.319   0.136   0.394    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      117       117   0.00091  102 3  11 22  0.48    30
                                                     29  0.46    32


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  543 (58 KB)
  Total size of DFA:  118 KB (2078 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  13.14u 0.16s 13.30t   Elapsed:  00:00:01
  Total cpu time:  13.14u 0.16s 13.30t   Elapsed:  00:00:01
  Start:  Fri May 10 07:59:45 2013   End:  Fri May 10 07:59:46 2013
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=ISS;IMP
GO:0009058 "biosynthetic process" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0001887 "selenium compound metabolic process" evidence=IMP
GO:0046500 "S-adenosylmethionine metabolic process" evidence=IMP
GO:0005829 "cytosol" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LTB2MMT1_ARATH2, ., 1, ., 1, ., 1, 20.72150.67520.0737yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00035361001
SubName- Full=Chromosome undetermined scaffold_77, whole genome shotgun sequence; (1090 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00038829001
SubName- Full=Chromosome chr5 scaffold_98, whole genome shotgun sequence; (807 aa)
     •  0.899
GSVIVG00018515001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (270 aa)
     •  0.899
GSVIVG00017439001
SubName- Full=Chromosome chr6 scaffold_15, whole genome shotgun sequence; (767 aa)
     •  0.899
GSVIVG00008913001
SubName- Full=Chromosome chr14 scaffold_211, whole genome shotgun sequence; (217 aa)
     •  0.899
GSVIVG00003836001
SubName- Full=Chromosome chr8 scaffold_150, whole genome shotgun sequence; (765 aa)
     •  0.899
GSVIVG00000520001
SubName- Full=Chromosome chr2 scaffold_105, whole genome shotgun sequence; (438 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
PLN02672 1082 PLN02672, PLN02672, methionine S-methyltransferase 3e-44
>gnl|CDD|215360 PLN02672, PLN02672, methionine S-methyltransferase Back     alignment and domain information 
 Score =  152 bits (386), Expect = 3e-44
 Identities = 61/86 (70%), Positives = 71/86 (82%)

Query: 9   QVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKR 68
           QVK IF+FLKNGF+E+S SLDL FED+ VADEKIPFLA LASALK  S+FP EPPAG+KR
Sbjct: 371 QVKTIFKFLKNGFHEVSGSLDLSFEDESVADEKIPFLAYLASALKGLSYFPCEPPAGSKR 430

Query: 69  FQNLIADFMKMYHHIPLNADCQSLQP 94
           F+NLIA FM++YHHIPL  D   + P
Sbjct: 431 FRNLIAGFMRIYHHIPLTPDNVVVFP 456

Length = 1082

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 117
PLN02672 1082 methionine S-methyltransferase 100.0
PRK05839 374 hypothetical protein; Provisional 97.52
PRK06108 382 aspartate aminotransferase; Provisional 97.41
PRK06855 433 aminotransferase; Validated 97.31
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 97.19
PRK07550 386 hypothetical protein; Provisional 97.12
PRK07681 399 aspartate aminotransferase; Provisional 97.03
PRK07777 387 aminotransferase; Validated 97.01
PLN02656 409 tyrosine transaminase 96.9
PLN00143 409 tyrosine/nicotianamine aminotransferase; Provision 96.89
PLN02187 462 rooty/superroot1 96.82
PRK07682 378 hypothetical protein; Validated 96.81
PRK07366 388 succinyldiaminopimelate transaminase; Validated 96.79
PRK05942 394 aspartate aminotransferase; Provisional 96.78
PRK08960 387 hypothetical protein; Provisional 96.65
PRK08361 391 aspartate aminotransferase; Provisional 96.61
PRK06107 402 aspartate aminotransferase; Provisional 96.61
PRK06207 405 aspartate aminotransferase; Provisional 96.47
PRK09276 385 LL-diaminopimelate aminotransferase; Provisional 96.47
PLN00145 430 tyrosine/nicotianamine aminotransferase; Provision 96.45
TIGR03540 383 DapC_direct LL-diaminopimelate aminotransferase. T 96.4
PRK07337 388 aminotransferase; Validated 96.35
PRK06348 384 aspartate aminotransferase; Provisional 96.33
PRK09147 396 succinyldiaminopimelate transaminase; Provisional 96.33
TIGR01264 401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 96.32
PRK09440 416 avtA valine--pyruvate transaminase; Provisional 96.31
PRK07590 409 L,L-diaminopimelate aminotransferase; Validated 96.27
PLN02607 447 1-aminocyclopropane-1-carboxylate synthase 96.26
PRK08636 403 aspartate aminotransferase; Provisional 96.24
TIGR03539 357 DapC_actino succinyldiaminopimelate transaminase. 96.22
TIGR03537 350 DapC succinyldiaminopimelate transaminase. Note: t 96.19
PRK08068 389 transaminase; Reviewed 96.18
PRK08912 387 hypothetical protein; Provisional 96.13
PRK09148 405 aminotransferase; Validated 96.12
PRK07683 387 aminotransferase A; Validated 96.1
PRK08363 398 alanine aminotransferase; Validated 96.0
PRK05764 393 aspartate aminotransferase; Provisional 95.97
TIGR01265 403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 95.97
PRK07309 391 aromatic amino acid aminotransferase; Validated 95.92
PLN02376 496 1-aminocyclopropane-1-carboxylate synthase 95.91
PLN02450 468 1-aminocyclopropane-1-carboxylate synthase 95.83
PRK08175 395 aminotransferase; Validated 95.79
PRK12414 384 putative aminotransferase; Provisional 95.74
PLN00175 413 aminotransferase family protein; Provisional 95.72
TIGR03538 393 DapC_gpp succinyldiaminopimelate transaminase. Thi 95.63
PTZ00433 412 tyrosine aminotransferase; Provisional 95.33
PRK03317 368 histidinol-phosphate aminotransferase; Provisional 95.28
PTZ00377 481 alanine aminotransferase; Provisional 95.17
PRK06836 394 aspartate aminotransferase; Provisional 95.17
PLN02368 407 alanine transaminase 95.13
PLN02231 534 alanine transaminase 95.12
PRK09082 386 methionine aminotransferase; Validated 95.11
PRK06290 410 aspartate aminotransferase; Provisional 94.82
PRK02610 374 histidinol-phosphate aminotransferase; Provisional 94.71
PRK09257 396 aromatic amino acid aminotransferase; Provisional 94.7
PRK07568 397 aspartate aminotransferase; Provisional 94.61
PRK06225 380 aspartate aminotransferase; Provisional 94.42
PRK07865 364 N-succinyldiaminopimelate aminotransferase; Review 94.2
PTZ00376 404 aspartate aminotransferase; Provisional 94.12
PRK09265 404 aminotransferase AlaT; Validated 93.61
PRK13355 517 bifunctional HTH-domain containing protein/aminotr 93.3
PRK05957 389 aspartate aminotransferase; Provisional 92.25
COG0436 393 Aspartate/tyrosine/aromatic aminotransferase [Amin 91.63
TIGR03542 402 DAPAT_plant LL-diaminopimelate aminotransferase. T 91.59
PRK03967 337 histidinol-phosphate aminotransferase; Provisional 90.69
PF00155 363 Aminotran_1_2: Aminotransferase class I and II 1-a 89.97
cd00609 350 AAT_like Aspartate aminotransferase family. This f 89.97
PRK07324 373 transaminase; Validated 87.87
PRK14808 335 histidinol-phosphate aminotransferase; Provisional 87.69
PRK14809 357 histidinol-phosphate aminotransferase; Provisional 85.73
PRK14807 351 histidinol-phosphate aminotransferase; Provisional 85.61
PRK07908 349 hypothetical protein; Provisional 84.87
COG1167 459 ARO8 Transcriptional regulators containing a DNA-b 84.82
PLN02397 423 aspartate transaminase 84.44
PRK01533 366 histidinol-phosphate aminotransferase; Validated 83.66
PRK03321 352 putative aminotransferase; Provisional 82.72
PRK08637 388 hypothetical protein; Provisional 81.42
>PLN02672 methionine S-methyltransferase Back     alignment and domain information 
Probab=100.00  E-value=1.7e-55  Score=398.41  Aligned_cols=106  Identities=60%  Similarity=0.856  Sum_probs=103.8

Q ss_pred             ccccchHHHHHHHHhhcchhccccccccccccccccccchHHHHHHHHhhhCCCCCCCCCCcchhHHHHHHHHHHhhccc
Q 040208            4 TFISGQVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYHHI   83 (117)
Q Consensus         4 ~~~PnqVk~if~FLknGF~e~ssSLDLsFeddsVAdEKIpFLA~Las~Lk~~s~fP~EpPaGs~~FRnLIagFmk~YHhI   83 (117)
                      -|||||||+||+||||||||+|+||||+|+||+|||||||||||||++||++|||||||||||++||||||||||+||||
T Consensus       366 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  445 (1082)
T PLN02672        366 LRQPNQVKTIFKFLKNGFHEVSGSLDLSFEDESVADEKIPFLAYLASALKGLSYFPCEPPAGSKRFRNLIAGFMRIYHHI  445 (1082)
T ss_pred             hcCchHHHHHHHHHHccchhhhhhccccccccccchhhccHHHHHHHHHccCCCCCCCCCccchHHHHHHHHHHHHhcCC
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCeeeccchhhhhhhhhcCCCc
Q 040208           84 PLNADCQSLQPKVINIDEEAAGNSSG  109 (117)
Q Consensus        84 Pl~~dnVvvfPSR~~~~e~a~~~~~~  109 (117)
                      |||+|||||||||++|||||+++-|-
T Consensus       446 ~~~~~~~~~~~~~~~~~~~~~~~~~~  471 (1082)
T PLN02672        446 PLTPDNVVVFPSRAVAIENALRLFSP  471 (1082)
T ss_pred             cCCccceEEeccHHHHHHHHHHhhCh
Confidence            99999999999999999999998763

>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 38.0 bits (87), Expect = 2e-04
 Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 6/33 (18%)

Query: 18 KNGFYEISSSLDLYFEDDLVADEKIPFLACLAS 50
          K    ++ +SL LY      AD+  P LA  A+
Sbjct: 19 KQALKKLQASLKLY------ADDSAPALAIKAT 45

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
2z61_A 370 Probable aspartate aminotransferase 2; amino acid 96.67
1b5p_A 385 Protein (aspartate aminotransferase); pyridoxal en 96.54
3h14_A 391 Aminotransferase, classes I and II; YP_167802.1, S 96.5
2o0r_A 411 RV0858C (N-succinyldiaminopimelate aminotransfera; 96.49
3jtx_A 396 Aminotransferase; NP_283882.1, structural genomics 96.48
3ezs_A 376 Aminotransferase ASPB; NP_207418.1, structural gen 96.43
1u08_A 386 Hypothetical aminotransferase YBDL; alpha beta pro 96.42
3if2_A 444 Aminotransferase; YP_265399.1, structura genomics, 96.39
3ele_A 398 Amino transferase; RER070207001803, structural gen 96.38
3fvs_A 422 Kynurenine--oxoglutarate transaminase 1; alpha bet 96.33
3g7q_A 417 Valine-pyruvate aminotransferase; NP_462565.1, str 96.31
1gd9_A 389 Aspartate aminotransferase; pyridoxal enzyme, temp 96.23
3e2y_A 410 Kynurenine-oxoglutarate transaminase 3; alpha beta 96.21
1ajs_A 412 Aspartate aminotransferase; PIG, in the presence o 96.06
2x5d_A 412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 96.05
1bw0_A 416 TAT, protein (tyrosine aminotransferase); tyrosine 96.01
1o4s_A 389 Aspartate aminotransferase; TM1255, structural gen 95.98
3g0t_A 437 Putative aminotransferase; NP_905498.1, putative a 95.96
2q7w_A 396 Aspartate aminotransferase; mechanism-based inhibi 95.87
2zc0_A 407 Alanine glyoxylate transaminase; alanine:glyoxylat 95.8
2dou_A 376 Probable N-succinyldiaminopimelate aminotransfera; 95.71
1yiz_A 429 Kynurenine aminotransferase; glutamine transaminas 95.68
1j32_A 388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 95.61
3nra_A 407 Aspartate aminotransferase; structural genomics, j 95.47
1yaa_A 412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 95.44
4f4e_A 420 Aromatic-amino-acid aminotransferase; ssgcid, stru 95.4
7aat_A 401 Aspartate aminotransferase; transferase(aminotrans 95.37
3dyd_A 427 Tyrosine aminotransferase; PLP, SGC, structural ge 95.34
2o1b_A 404 Aminotransferase, class I; aminotrasferase; HET: P 95.31
1xi9_A 406 Putative transaminase; alanine aminotransferase, s 95.27
3fsl_A 397 Aromatic-amino-acid aminotransferase; tyrosine ami 95.25
3aow_A 448 Putative uncharacterized protein PH0207; protein-P 95.19
3b46_A 447 Aminotransferase BNA3; kynurenine aminotransferase 95.09
3piu_A 435 1-aminocyclopropane-1-carboxylate synthase; fruit 94.79
1vp4_A 425 Aminotransferase, putative; structural genomics, j 94.78
2gb3_A 409 Aspartate aminotransferase; TM1698, structural gen 94.76
3tcm_A 500 Alanine aminotransferase 2; pyridoxal phosphate (P 94.75
2hox_A 427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 94.61
3qgu_A 449 LL-diaminopimelate aminotransferase; L-lysine, pyr 94.44
2x5f_A 430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 94.34
3fdb_A 377 Beta C-S lyase, putative PLP-dependent beta-cystat 94.3
2r2n_A 425 Kynurenine/alpha-aminoadipate aminotransferase mit 93.91
3cq5_A 369 Histidinol-phosphate aminotransferase; PLP, PMP, a 93.86
3ihj_A 498 Alanine aminotransferase 2; helix, structural geno 93.75
1c7n_A 399 Cystalysin; transferase, aminotransferase, pyridox 93.71
2ay1_A 394 Aroat, aromatic amino acid aminotransferase; HET: 93.61
3k7y_A 405 Aspartate aminotransferase; aminotrans pyridoxal p 92.85
1iay_A 428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 92.77
1d2f_A 390 MALY protein; aminotransferase fold, large PLP-bin 92.53
3ei9_A 432 LL-diaminopimelate aminotransferase; lysine biosyn 91.99
3bwn_A 391 AT1G70560, L-tryptophan aminotransferase; auxin sy 91.85
1v2d_A 381 Glutamine aminotransferase; PLP, riken structural 91.11
3asa_A 400 LL-diaminopimelate aminotransferase; PLP dependent 90.54
3dzz_A 391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 90.5
3kax_A 383 Aminotransferase, classes I and II; PLP, C-S lyase 90.02
4dq6_A 391 Putative pyridoxal phosphate-dependent transferas; 89.49
3l8a_A 421 METC, putative aminotransferase, probable beta-cys 88.87
1uu1_A 335 Histidinol-phosphate aminotransferase; histidine b 88.36
3t18_A 413 Aminotransferase class I and II; PSI-biology, MCSG 87.09
3ppl_A 427 Aspartate aminotransferase; dimer, PLP-dependent t 86.71
3rq1_A 418 Aminotransferase class I and II; structural genomi 85.39
3ftb_A 361 Histidinol-phosphate aminotransferase; structural 84.4
3f6t_A 533 Aspartate aminotransferase; YP_194538.1, STRU geno 83.86
3fkd_A 350 L-threonine-O-3-phosphate decarboxylase; structura 83.36
2zyj_A 397 Alpha-aminodipate aminotransferase; alpha-aminoadi 83.06
3b1d_A 392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 83.13
3op7_A 375 Aminotransferase class I and II; PLP-dependent tra 82.32
3euc_A 367 Histidinol-phosphate aminotransferase 2; YP_297314 81.82
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
Probab=96.67  E-value=0.0097  Score=42.68  Aligned_cols=101  Identities=16%  Similarity=0.025  Sum_probs=66.7

Q ss_pred             ccccchHHHHHHHHhhcchhccccccccccccccccccchHHHHHHHHhhhCCCCCCCCCCcchhHHHHHHHHHHhhccc
Q 040208            4 TFISGQVKKIFEFLKNGFYEISSSLDLYFEDDLVADEKIPFLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYHHI   83 (117)
Q Consensus         4 ~~~PnqVk~if~FLknGF~e~ssSLDLsFeddsVAdEKIpFLA~Las~Lk~~s~fP~EpPaGs~~FRnLIagFmk~YHhI   83 (117)
                      ...|..+..+++..+.-=.+-..-+||+..+-...- --.....+...++.. ..-|.++.|...+|..||.++...+++
T Consensus         8 ~~~~~~~~~~~~~~~~~~~~g~~~i~l~~~~~~~~~-~~~v~~a~~~~~~~~-~~~y~~~~~~~~l~~~la~~~~~~~g~   85 (370)
T 2z61_A            8 NFESFEVMDILALAQKLESEGKKVIHLEIGEPDFNT-PKPIVDEGIKSLKEG-KTHYTDSRGILELREKISELYKDKYKA   85 (370)
T ss_dssp             HCCCCTTHHHHHHHHHHHHTTCCCEECCCCSCSSCC-CHHHHHHHHHHHHTT-CCSCCCTTCCHHHHHHHHHHHHHHSSC
T ss_pred             hccccHHHHHHHHHHHHHhcCCCEEEccCCCCCCCC-CHHHHHHHHHHHHcC-ccCCCCCCCCHHHHHHHHHHHHHHhCC
Confidence            356677777777654210000123444443322111 012355666677653 345667889999999999999999999


Q ss_pred             cCCCCCeeeccchhhhhhhhhcC
Q 040208           84 PLNADCQSLQPKVINIDEEAAGN  106 (117)
Q Consensus        84 Pl~~dnVvvfPSR~~~~e~a~~~  106 (117)
                      +.++++|++.++-..+++-++..
T Consensus        86 ~~~~~~v~~~~g~~~a~~~~~~~  108 (370)
T 2z61_A           86 DIIPDNIIITGGSSLGLFFALSS  108 (370)
T ss_dssp             CCCGGGEEEESSHHHHHHHHHHH
T ss_pred             CCChhhEEECCChHHHHHHHHHH
Confidence            99999999999999999888763
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
d1bw0a_ 412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 97.03
d1b5pa_ 382 Aspartate aminotransferase, AAT {Thermus thermophi 96.91
d1iaya_ 428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 96.75
d1j32a_ 388 Aspartate aminotransferase, AAT {Phormidium lapide 96.74
d2gb3a1 389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 96.66
d1m7ya_ 431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 96.64
d1c7na_ 394 Cystalysin {Treponema denticola [TaxId: 158]} 96.51
d2r5ea1 418 Kynurenine--oxoglutarate transaminase I {Yellowfev 96.31
d1o4sa_ 375 Aspartate aminotransferase, AAT {Thermotoga mariti 96.3
d1xi9a_ 395 Putative alanine aminotransferase {Pyrococcus furi 96.18
d1d2fa_ 361 Modulator in mal gene expression, MalY {Escherichi 96.06
d1wsta1 403 Multiple substrate aminotransferase, MSAT {Thermoc 96.02
d1gdea_ 388 Aromatic aminoacid aminotransferase, AroAT {Archae 95.76
d1vp4a_ 420 Putative aminotransferase TM1131 {Thermotoga marit 95.23
d1u08a_ 382 Putative methionine aminotransferase YdbL {Escheri 95.19
d3tata_ 397 Aromatic aminoacid aminotransferase, AroAT {Escher 95.15
d1w7la_ 418 Kynurenine--oxoglutarate transaminase I {Human (Ho 94.63
d7aata_ 401 Aspartate aminotransferase, AAT {Chicken (Gallus g 93.86
d2f8ja1 334 Histidinol-phosphate aminotransferase HisC {Thermo 93.67
d2q7wa1 396 Aspartate aminotransferase, AAT {Escherichia coli 93.25
d2ay1a_ 394 Aromatic aminoacid aminotransferase, AroAT {Paraco 92.37
d1v2da_ 368 Glutamine aminotransferase {Thermus thermophilus [ 91.86
d1ajsa_ 412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 86.62
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Tyrosine aminotransferase (TAT)
species: Trypanosoma cruzi [TaxId: 5693]

Probab=97.03  E-value=0.0011  Score=47.81  Aligned_cols=98  Identities=13%  Similarity=0.065  Sum_probs=67.6

Q ss_pred             chHHHHHHHHhhcchhccccccccccc-cccccccch--HHHHHHHHhhhCCCCCCCCCCcchhHHHHHHHHHHhhc---
Q 040208            8 GQVKKIFEFLKNGFYEISSSLDLYFED-DLVADEKIP--FLACLASALKEHSFFPYEPPAGTKRFQNLIADFMKMYH---   81 (117)
Q Consensus         8 nqVk~if~FLknGF~e~ssSLDLsFed-dsVAdEKIp--FLA~Las~Lk~~s~fP~EpPaGs~~FRnLIagFmk~YH---   81 (117)
                      +.++.|++-++-.-.. ..-+||+.-+ |.-.+..++  .+..+...+.....+-|.|+.|...+|.-||.|++..+   
T Consensus        14 ~pir~~~~~~~~~~~~-~~vI~L~~G~p~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~~~~G~~~LReaia~~~~~~~~~~   92 (412)
T d1bw0a_          14 NPIRTVSDNAKPSPSP-KPIIKLSVGDPTLDKNLLTSAAQIKKLKEAIDSQECNGYFPTVGSPEAREAVATWWRNSFVHK   92 (412)
T ss_dssp             CHHHHHHHTCCCCCSC-SCCEECCCCCTTTTSCSCCCHHHHHHHHHHHHTTCSSSCCCTTCCHHHHHHHHHHHHHHHCCS
T ss_pred             cHHHHHHHhcCCCCCC-CCcEECcCCCCCCCCCccccHHHHHHHHHHhhCCCCCCCCCCcCCHHHHHHHHHHHHHhcCcc
Confidence            5567777655422110 0124565543 222333332  34667777777888889999999999999999997653   


Q ss_pred             ---cccCCCCCeeeccchhhhhhhhhcC
Q 040208           82 ---HIPLNADCQSLQPKVINIDEEAAGN  106 (117)
Q Consensus        82 ---hIPl~~dnVvvfPSR~~~~e~a~~~  106 (117)
                         ..+++|+||+|.+.-..++..+++.
T Consensus        93 ~~~~~~~~~~~I~it~G~~~al~~~~~~  120 (412)
T d1bw0a_          93 EELKSTIVKDNVVLCSGGSHGILMAITA  120 (412)
T ss_dssp             TTTGGGCCGGGEEEESHHHHHHHHHHHH
T ss_pred             cccCCCCCCCeEEEecccccchhhhhhh
Confidence               4789999999999998888887763
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure