Citrus Sinensis ID: 040300

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-----
MSDRLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKILAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMKADLCTDLDLNQVIDRNVGDLSGGELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVVRSLLRPNSYVIVVEHDLSVLDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFRVAETPQESAEEIETYARYKYPTMVKTQGNFKLKVVEGEFTDSQIIVMLGENGTGKTTFIRMLAGLLKPDSVEDSDVEIPEFNVSYKPQKISPKFQSTVRHLLHQKIRDSYTHPQFVSDVMKPLLIEQLMDQEVVNLSGGELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIMATYLADRVIVYEGQPSVDCVANAPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLDSTKDRDQKAAGSYYYLDD
ccccccEEEEEEccccccccccHHHHHccccccccccEEEEccccccEEEEcccccccccccccccccEEEEEccccccccccCEEccccccccccccccccccEEEEEccccccHHHHHHHHHcccccccccccccccHHHHHccccHHHHHHHHHHHHccccccccccccccccHHHHcccccccccHHHHHHHHHHHHHcccccHHHcccccccccHHHHHHHHHHHHcccccEEEECcccccccHHHHHHHHHHHHHHHccccEEEEEEccHHHHHccccEEEEEEcccCEEEEEcccccHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHEEEEcccEEEEcccEEEEEEEEEEEcccEEEEEccccccHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHcHHHccccccHHHHHHHHHccccHHHccccccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEccccCEEECccccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHccccccccc
****LTR*AIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKILAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMKADLCTDLDLNQVIDRNVGDLSGGELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVVRSLLRPNSYVIVVEHDLSVLDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFRVA********EIETYARYKYPTMVKTQGNFKLKVVEGEFTDSQIIVMLGENGTGKTTFIRMLAGLLKPDSVED***EIPEFNVSYKPQKISPKFQSTVRHLLHQKIRDSYTHPQFVSDVMKPLLIEQLMDQEVVNLSGGELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIMATYLADRVIVYEGQPSVDCVANAPQSLLTGMNLFLSHLDITFRRDPTNFRPRIN***STKDRDQKAAGSYYYLD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDRLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKILAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMKADLCTDLDLNQVIDRNVGDLSGGELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVVRSLLRPNSYVIVVEHDLSVLDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFRVAETPQESAEEIETYARYKYPTMVKTQGNFKLKVVEGEFTDSQIIVMLGENGTGKTTFIRMLAGLLKPDSVEDSDVEIPEFNVSYKPQKISPKFQSTVRHLLHQKIRDSYTHPQFVSDVMKPLLIEQLMDQEVVNLSGGELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIMATYLADRVIVYEGQPSVDCVANAPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLDSTKDRDQKAAGSYYYLDD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ABC transporter E family member 2 confidentQ8LPJ4
ATP-binding cassette sub-family E member 1 Antagonizes the binding of 2-5A (5'-phosphorylated 2',5'-linked oligoadenylates) by RNase L through direct interaction with RNase L and therefore inhibits its endoribonuclease activity. May play a central role in the regulation of mRNA turnover. Antagonizes the anti-viral effect of the interferon-regulated 2-5A/RNase L pathway.confidentP61222
ATP-binding cassette sub-family E member 1 Antagonizes the binding of 2-5A (5'-phosphorylated 2',5'-linked oligoadenylates) by RNase L through direct interaction with RNase L and therefore inhibits its endoribonuclease activity. May play a central role in the regulation of mRNA turnover. Antagonizes the anti-viral effect of the interferon-regulated 2-5A/RNase L pathway. May act as a chaperone for post-translational events during HIV-1 capsid assembly.confidentP61221

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 82-145,166-545
View the alignment between query and template
View the model in PyMOL
Template: 3J16, chain B
Confidence level:very confident
Coverage over the Query: 1-605
View the alignment between query and template
View the model in PyMOL